KEGG   Bartonella sp. Raccoon60: Bra60_007460Help
Entry
Bra60_007460      CDS       T05326                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferasesubunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
barr  Bartonella sp. Raccoon60
Pathway
barr00970  Aminoacyl-tRNA biosynthesis
barr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:barr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bra60_007460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:barr03029]
    Bra60_007460
Enzymes [BR:barr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Bra60_007460
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Bra60_007460
Mitochondrial biogenesis [BR:barr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Bra60_007460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AQX26748
LinkDB All DBs
Position
complement(803213..804712)
Genome map
AA seq 499 aa AA seqDB search
MKIVDARLPDPKRFISGATGDWEVIIGMEVHAQVISNSKLFSGASTKFGAEPNNHVSLVD
AAMPGMLPVINQACIRQAVRTGLGLKAKINLKSVFDRKNYFYPDLPQGYQISQFQYPIVG
EGKVVVSIGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS
KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGGPFGTRCEVKNV
NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDATKGETRSMRSKEEAYDYRYFPDPD
LLPLELDQVFVDTLASELPELPDDIKARFINEMGLTAYDASILVTEKAIADYFEEVAHGR
DGKMVANWVINDLLGALNKDNRDIEDTPITANQLGAIIDLIKDGTISGKIAKDLFEIIWN
EGGDPHQIVEKRGMKQVTDAGVIERAVDEIIINNPDKVSQAREKPALIGWFVGQVMKATE
GKANPQTVNKLVKSKLGID
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttgatgctcgtcttcctgatcctaagcgttttatttctggagctacaggt
gattgggaagttattattggcatggaagttcatgcgcaagtcatatcaaattcaaagctt
ttttcaggtgcatcaactaagtttggagctgagccgaataatcacgtgtcacttgttgat
gcagctatgcctggtatgttgcctgttattaatcaagcatgtattcgtcaagctgttcga
actggtttaggattaaaagctaaaattaatttaaaatctgtttttgatcgtaaaaactat
ttttatccagatttaccgcaggggtatcagatttcacaatttcagtatcctatcgtaggt
gaagggaaagtagttgtatctattggaccagattcgaatggtcagtttgaggatattgaa
attgggattgaaaggttgcaccttgagcaagatgctggaaagtctatgcatgaccagcat
ccaacaatgtcttttgtagatcttaatcgctcaggtgttgctcttatggaaattgtttct
aaaccagatatgcgatcatcagaagaagcaaaagcctatatgacaaaattacgtacaatt
gttcgttatttgggtacttgtgatgggaatatggatgagggctctatgcgtgcagatgta
aatatatctgttcgccgtcctggtggaccttttggaacgcgctgtgaagttaaaaatgtt
aattcgattcgttttattggacaagcaattgaatatgaggcacgtcgccaaattgcaatt
ttagaagatgggggtgtaatagatcaggaaactcgactttttgatgcaacaaaaggtgaa
acacgatctatgcgttcaaaagaggaagcatatgactatcgttattttcctgatcctgat
cttttaccgttagagcttgatcaggtttttgtagatactttagcttcagaattacctgaa
ttacctgatgatataaaggcgcgctttatcaatgagatggggttaaccgcatatgatgct
tctattcttgtaacagaaaaagcaattgcagattatttcgaagaagtagcacatgggcgg
gatggaaagatggttgctaattgggtgatcaatgatcttttaggcgctttaaataaagat
aatcgtgatattgaagatactccgattacagcaaaccaattgggagcaattattgatctt
atcaaagatggaactatttctggaaaaattgcaaaagatctatttgaaattatttggaat
gaaggtggagatccacatcagattgtagaaaagcgtggtatgaagcaggtaacggatgca
ggagttattgaaagagctgttgatgaaattattatcaataaccctgataaagtttctcaa
gcacgagagaagcctgctttgattggttggtttgttggacaggtaatgaaggcaacagaa
ggtaaggcaaatcctcaaacagttaataaattagttaaaagtaagcttgggatagattaa

DBGET integrated database retrieval system