KEGG   Bacillus anthracis Sterne: BAS0329Help
Entry
BAS0329           CDS       T00184                                 

Definition
(RefSeq) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bat  Bacillus anthracis Sterne
Brite
KEGG Orthology (KO) [BR:bat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BAS0329
Enzymes [BR:bat01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BAS0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C DAO K_oxygenase Glutaredoxin NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 2848675
NCBI-ProteinID: YP_026609
LinkDB All DBs
Position
complement(354369..355895)
Genome map
AA seq 508 aa AA seqDB search
MILDADIKTQLSQYLQLMENDILLKVSAGNDDVSKDMLALVDELATMSSKITVEKVELER
TPSFSVNRPGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVESKDIMAVPTVFLNGESF
GSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELE
NGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFTGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
NNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaaacacaactatcccaataccttcagttaatggagaac
gatattttacttaaagtaagcgcaggaaacgacgacgtatctaaagatatgttagctcta
gtagacgaattagctactatgtcatctaagattacagtagaaaaagttgaattagagaga
acaccaagctttagcgtaaaccgccctggtgaagacactggtgtcgtattcgctggtatt
ccattaggacacgaatttacatcactagtgttagctttactacaagtaagtggacgcgct
ccaaaagttgaacaaaaattaatcgatcaaattaaaaacattcaaggcgaatatcatttt
gaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaagctcttaacgta
atgagcgttctaaactctggtattacacatactatgattgatggcgctgcattcaaagag
gaagtagaaagcaaagacatcatggcagtaccaacagttttcctaaacggcgaatctttc
ggaagcggtcgtatgacactggaagaaattttagctaaaatgggtaacggtccagatgca
tcagagctttctgataaagatccatacgatgttcttgttgttggtggcggccctgctggt
gcaagtgcagcaatttatgcagcacgtaaaggcatccgcactggtatcgttgctgagcgc
ttcggtggtcaagtaatggatactatgggcattgagaacttcatcagcgtaaaacgcact
gaaggtcctaagctagtagcaagccttgaagagcacgtaaaagaatacgacatcgatgta
atgaatctacaacgtgcaaaacgtttagagaaaaaagaacttattgaagtggaacttgaa
aacggcgctattctgaaaagtaagagcgtaatcgtttcaacaggtgctcgctggcgtaac
gttggcgtaccaggtgaagctgagttcaaaaataaaggtgtagcatactgcccacactgt
gacggtccattattcactggaaaagacgtagcagttatcggcggcggtaactctggtatt
gaagcagctatcgacttagcaggtattgttaagcacgtaactgttcttgaattcatgcca
gaattaaaagctgatgctgtattacaagaacgtcttaacagcttaccaaacgtaactgtt
ctgaaaaacgttcaaacgaaagaaattactggtactgataaagtaaacggtatttcttac
atcgatcgtgaaactgaagaagttcatcacgttgaattacaaggtgtattcgtacaaatc
ggtcttgttccaaacacagactggttaggcgaaacagttgaacgcgttcgcggtgaaatc
gtaacagacaagcacggcgctacaaacgtaccaggagtgtttgctgcaggtgactgtaca
aataatccgtacaaacaaatcatcatctctatgggttcaggtgcaaacgcagctttaggt
gcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system