KEGG   Bacillus velezensis FZB42: RBAM_000820Help
Entry
RBAM_000820       CDS       T00582                                 

Gene name
yacC
Definition
(GenBank) YacC
  KO
K04083  molecular chaperone Hsp33
Organism
bay  Bacillus velezensis FZB42
Brite
KEGG Orthology (KO) [BR:bay00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bay03110]
    RBAM_000820 (yacC)
Chaperones and folding catalysts [BR:bay03110]
 Heat shock proteins
  HSP33
   RBAM_000820 (yacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ABS72520
UniProt: A7Z0J4
LinkDB All DBs
Position
80510..81385
Genome map
AA seq 291 aa AA seqDB search
MDYLIKAIAYDGKVRAYAARTTDMVNEAQRRHDTWPTASAAIGRTMTASLMLGAMLKGED
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPHVHFDLNEQGKLDVRRAVGTDGTLSVVK
DLGLRDYFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLL
PGTDEETISTIEKQLSQIEPISKLIQKGLTPEEILEEVLGQKPDVLETMPVKFHCSCSKD
RFETAILGLGKKEIQDMIEEDGKAEAVCHFCNEKYLFTKEELEELRDETTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttaattaaagcaattgcatatgacggtaaagtgcgggcttatgcagccaga
acgacagatatggtaaatgaagcgcaaagaaggcatgacacgtggccgacggcatcagcc
gcaatcggccggacgatgacagcttctctgatgctaggagcgatgcttaagggtgaagat
aagctgacagtcaaaatagaaggcggcggcccgatcggagccattgtcgcagatgcgaac
gcaaagggtgaggtaagagcatacgtatcaaacccgcacgttcattttgatctcaatgaa
caagggaaactggatgtcagacgggcggtcggaactgatggaacactcagtgtcgtaaaa
gatttgggcttgcgtgattattttacgggacaagtagagattgtctcgggtgaactcggt
gacgacttcacatattatcttgtttcttctgaacaagtcccttcatctgtcggcgtaggt
gttctggtaaatcctgataacacgattctcgctgcgggcgggttcatcattcagcttctt
ccggggactgatgaagaaaccatttcaacaattgaaaagcaattatctcaaatcgaaccg
atttcaaaattgattcaaaaaggcctgacaccggaagaaatcttggaagaagttctgggt
caaaaaccggacgttctcgaaacaatgccggtcaaatttcactgttcttgttcaaaagat
cgattcgaaacggccattttaggactaggcaaaaaagaaatacaagatatgatagaagaa
gacggaaaagccgaagcggtttgccatttttgtaatgagaagtatttatttacaaaagaa
gaactggaagagcttcgtgacgaaacaacccgctag

DBGET integrated database retrieval system