Bradyrhizobium betae: F8237_33960 Help Entry F8237_33960       CDS       T06368                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bbet  Bradyrhizobium betae Brite KEGG Orthology (KO) [BR:bbet00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bbet03032]     F8237_33960    03036 Chromosome and associated proteins [BR:bbet03036]     F8237_33960    03400 DNA repair and recombination proteins [BR:bbet03400]     F8237_33960 DNA replication proteins [BR:bbet03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     F8237_33960 Chromosome and associated proteins [BR:bbet03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     F8237_33960 DNA repair and recombination proteins [BR:bbet03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       F8237_33960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QFI76956 UniProt:  A0A4Q1UIH9 LinkDB All DBs Position complement(7076400..7076696) Genome browser AA seq 98 aa AA seqDB search MAKMTKTQLIDAIAEGTQLSKNDVKSVIEYMATVGYKELNESGEFVIPGFVKMSVVNKPA TEARMGVNPFTKEPMQFAAKPASKSVKASPLKVAKDSV NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcgaagatgaccaagactcaattgatcgatgcaattgccgagggcacgcagttgtcg aagaacgacgtgaagtcggtcatcgagtacatggcgacggtcggatacaaggagctcaac gagtccggcgagttcgtcattcccggtttcgtgaagatgtcggtcgtgaacaagccggcg accgaagcccgcatgggcgtcaatcccttcaccaaggagccgatgcagttcgcggccaag ccggcgagcaagtcggtcaaggcatcgccgctgaaggttgccaaggactcggtctga

DBGET integrated database retrieval system