Bifidobacterium bifidum PRL2010: BBPR_0160 Help Entry BBPR_0160         CDS       T01340                                  Name (GenBank) Glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism bbp  Bifidobacterium bifidum PRL2010 Brite KEGG Orthology (KO) [BR:bbp00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BBPR_0160 Enzymes [BR:bbp01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      BBPR_0160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_9 GST_N_3 GST_N_2 Glrx-like Thioredoxin Motif Other DBs NCBI-ProteinID:  ADP35294 UniProt:  A0A0H3EAF3 LinkDB All DBs Position 190085..190333 Genome browser AA seq 82 aa AA seqDB search MAIDVYGATWCGDCHRAKNALDRFGAAYTWHDIEQEEGAADRAVEISGQKHIPVVLYGDG SFQVEPSVVDIQNKLNELGLLG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcgattgatgtatatggtgcaacatggtgcggcgactgccaccgtgccaagaacgcg ctcgaccggttcggcgccgcttacacgtggcacgacatcgagcaggaggagggcgcggcc gaccgtgccgttgagatcagcggccaaaaacacatcccggtcgtgctctatggcgacggg tcgttccaggtcgagccgtccgtcgtggacatccagaacaagctcaacgagcttggcctg ctcgggtga

DBGET integrated database retrieval system