KEGG   Bubalus bubalis (water buffalo): 102398103
Entry
102398103         CDS       T05912                                 

Gene name
EGFR
Definition
(RefSeq) LOW QUALITY PROTEIN: epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04020  Calcium signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04144  Endocytosis
bbub04151  PI3K-Akt signaling pathway
bbub04510  Focal adhesion
bbub04520  Adherens junction
bbub04540  Gap junction
bbub04630  JAK-STAT signaling pathway
bbub04810  Regulation of actin cytoskeleton
bbub04912  GnRH signaling pathway
bbub04915  Estrogen signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04926  Relaxin signaling pathway
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04934  Cushing syndrome
bbub05160  Hepatitis C
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102398103 (EGFR)
   04012 ErbB signaling pathway
    102398103 (EGFR)
   04014 Ras signaling pathway
    102398103 (EGFR)
   04015 Rap1 signaling pathway
    102398103 (EGFR)
   04630 JAK-STAT signaling pathway
    102398103 (EGFR)
   04066 HIF-1 signaling pathway
    102398103 (EGFR)
   04068 FoxO signaling pathway
    102398103 (EGFR)
   04020 Calcium signaling pathway
    102398103 (EGFR)
   04072 Phospholipase D signaling pathway
    102398103 (EGFR)
   04151 PI3K-Akt signaling pathway
    102398103 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102398103 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102398103 (EGFR)
   04520 Adherens junction
    102398103 (EGFR)
   04540 Gap junction
    102398103 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102398103 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102398103 (EGFR)
   04915 Estrogen signaling pathway
    102398103 (EGFR)
   04921 Oxytocin signaling pathway
    102398103 (EGFR)
   04926 Relaxin signaling pathway
    102398103 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    102398103 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102398103 (EGFR)
   05206 MicroRNAs in cancer
    102398103 (EGFR)
   05205 Proteoglycans in cancer
    102398103 (EGFR)
   05230 Central carbon metabolism in cancer
    102398103 (EGFR)
   05231 Choline metabolism in cancer
    102398103 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102398103 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102398103 (EGFR)
   05212 Pancreatic cancer
    102398103 (EGFR)
   05225 Hepatocellular carcinoma
    102398103 (EGFR)
   05226 Gastric cancer
    102398103 (EGFR)
   05214 Glioma
    102398103 (EGFR)
   05218 Melanoma
    102398103 (EGFR)
   05219 Bladder cancer
    102398103 (EGFR)
   05215 Prostate cancer
    102398103 (EGFR)
   05213 Endometrial cancer
    102398103 (EGFR)
   05224 Breast cancer
    102398103 (EGFR)
   05223 Non-small cell lung cancer
    102398103 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102398103 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102398103 (EGFR)
   05171 Coronavirus disease - COVID-19
    102398103 (EGFR)
   05163 Human cytomegalovirus infection
    102398103 (EGFR)
   05165 Human papillomavirus infection
    102398103 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102398103 (EGFR)
   01522 Endocrine resistance
    102398103 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102398103 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102398103 (EGFR)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102398103 (EGFR)
Protein kinases [BR:bbub01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102398103 (EGFR)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102398103 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   102398103 (EGFR)
  Exosomal proteins of bladder cancer cells
   102398103 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Borrelia_P83 Kinase-like Kdo
Other DBs
NCBI-GeneID: 102398103
NCBI-ProteinID: XP_025128865
LinkDB
Position
21
AA seq 1240 aa
MRAPSVLRGRVPRRRDQRTAAAASRPSAEPGAMRLSGAGRAALLVLLAAHFQASLALEEK
KVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYMQSSYNLSFLKTIQEVAGY
VLIALNTVEKIPLENLQIIRGNVLYENTHALAVLSNYGANKTGLRELPLRNLQEILQGAV
RFSNNPVLCNVETIQWRDIVNPDFLSNMTGDFQNQQGNCPKCDPACLNRSCWGAGEENCQ
KLTKIICAQQCSGRCRGRSPSDCCHNQCAAGCTGPRESDCLVCRRFRDEATCKDTCPPLM
LYDPTTYEMKVNPLGKYSFGATCVKKCPRNYVVTDHGSCVRACSSDSQEVEEDGVRKCKK
CDGPCGKVCNGIGIGEFKDTLSINATNIKHFRNCTSISGDLHILPVAFRGDSFTRTAPLD
PKELDILRTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVGLDITSL
GLRSLKEISDGDVIISGNRNLCYADTIRWKKLFGTSTQKTKILNNRSEKQCKATGHICHP
LCSSEGCWGPGPKYCMSCQNFSRGKECVGKCNILEGEPREFVENSECVQCHPECLPQAMN
VTCTGRGPGNCVKCAHYIDGPHCVKTCPAGVAGENGTLIWKFADASHVCHLCHPNCTYGC
EGPGLEGCPPNGPKIPSIATGIVGGLLLVLVLALSVGLFMRRRHIVRKRTLRRLLQEREL
VEPLTPSGEAPNQALLRILKETEFKKVKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELR
EATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDN
IGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKE
YHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISTVLE
KGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELILEFSKMARDPQRYLVIQGDERMH
LPSPTDSNFYRALMDEEDMEDVVDADEYLVPQQGFFHSPATSWTPLLSSLSTSSNTPTVT
CVDRNGSYPLKEDSFLQRYSSDPTGALIEDSMDDAFLPVPEYVNQSVPKRPAGSVQNPVY
HNQPLYPAPGRDPQYQNSRSNAVDNPEYLNTTHPACINGVLDGPALWAQKGSHQISLDNP
DYQQAFFPKEAKSNGIFKGPAAENAEYLRAAPAGSDFTGA
NT seq 3723 nt   +upstreamnt  +downstreamnt
atgcgagccccgtccgtcctgcgcggccgtgtcccgcgccgccgagaccagcgcacggcg
gccgctgcgtcccgaccgagtgcggagcccggcgcgatgcgactctccggggcgggccgc
gcggcgctcctggtgctgctggcagcgcacttccaggcgagtctagcgctggaggagaag
aaagtttgccaagggacaagtaacaagctcacccagttgggcacttttgaagaccacttt
ctgagcctacagaggatgttcaacaactgtgaggtggtccttgggaatttggaaattacc
tacatgcagagtagttacaacctttcttttctcaagaccatccaggaggttgccggctat
gtactcattgccctcaacacagtggagaagattccgttggaaaacctgcagatcatccga
ggaaatgtgctttatgaaaacacccatgccttagcggtcttatccaactatggagcaaac
aaaaccggactgagggagctgcccttgagaaacttacaggaaattctgcaaggtgccgtg
cgattcagcaacaaccctgtcctctgcaacgtggagaccatccagtggcgggacatcgtc
aaccctgattttctaagcaacatgacaggggactttcagaaccagcagggcaactgccca
aagtgtgatccagcctgtctcaacagaagctgctggggtgccggggaggagaactgccag
aaattgaccaaaatcatctgtgcccagcagtgttccgggcgctgccgcggcaggtccccc
agcgactgctgccacaaccagtgtgccgctggctgcacggggccacgggagagcgactgc
ctggtctgccgcaggttccgtgatgaagccacctgcaaggacacgtgtccgccactcatg
ctctatgaccctaccacctacgaaatgaaggtcaacccgctggggaagtacagctttggt
gccacctgtgtcaagaagtgtccccgtaactacgtggtgacagaccacggctcctgcgtc
cgcgcctgcagctctgacagccaggaggtagaggaggatggcgtccgcaagtgtaaaaag
tgtgacgggccttgtggcaaagtttgtaacggaataggaatcggtgagtttaaagacaca
ctttccataaatgctacaaacattaaacacttcagaaactgcacatccatcagtggagat
cttcatatcctgccagtagcatttaggggtgactccttcacacgtactgcacctctggac
ccgaaagaactggacattctaagaactgtaaaagaaataacagggtttttgctgattcag
gcctggcctgaaaataggactgacctccatgcttttgagaacctggaaatcatacgtggc
agaacaaagcaacatggccagttttctcttgcggttgtcggcctggatatcacatctttg
ggattacgctccctcaaggagataagtgatggtgatgtgataatttcaggaaatcgaaac
ttgtgctatgcagatacgatacgctggaaaaaactttttgggacctcaactcagaaaacc
aaaattttaaacaacaggagtgaaaaacagtgcaaggccacaggccacatctgtcacccg
ctgtgctcatcagagggctgctggggacctggacccaaatactgcatgtcctgtcagaac
ttcagtcgtggcaaggagtgtgtgggaaagtgcaacattctagagggagagcccagagaa
ttcgtggagaactccgagtgtgtgcagtgccatccagaatgcctgccccaggccatgaac
gtgacctgcactggacgcggaccaggcaactgtgtaaagtgtgcccactacattgatggc
cctcactgcgtcaagacctgccctgctggagtcgcgggagagaatggcaccctgatctgg
aagtttgcagatgccagtcacgtgtgccacctgtgccaccccaactgcacctatggctgt
gaagggccaggtctcgaaggctgtccaccaaatgggcccaagatcccgtccattgccacg
ggcatcgtgggcggcctgctgctggtgttggtgctggccctgagcgtcggcctcttcatg
cgcaggcgccacatcgtgcgcaagcgcacactgcgccggctgctgcaagagcgtgagctc
gtggagcctctgacgcccagcggagaagctcccaaccaagctctcttgaggatcctaaag
gaaacagaattcaagaaggtcaaggtgctgggctcaggagcattcggcaccgtgtacaag
ggactctggatcccagaaggcgagaaggttaaaattcctgtagctatcaaggaattaaga
gaagccacatctccaaaagccaacaaggaaattcttgatgaggcctacgtgatggccagt
gtggacaacccccatgtgtgccgcctcctgggcatctgcctgacctccaccgtgcagctc
atcacacagcttatgcccttcggctgcctgctggactacgtccgcgagcacaaggacaac
atcggctcccagtacctgctcaactggtgtgtgcagatcgcaaagggcatgaattacctg
gaagaccggcgcttggtgcatagggacctggcggccaggaacgtgctggtgaagacgcca
cagcacgtgaagatcacagacttcgggctggccaagctgctgggtgccgaggagaaggag
tatcacgcagaaggaggcaaggtccctatcaaatggatggctttggaatcaattttacac
cgaatttatacccatcagagtgatgtctggagctatggagtcactgtttgggagttgatg
acctttggatccaagccttacgatggaatccctgcgagtgagatctcgactgtcctggag
aaaggagagcgcctcccgcagccacccatctgcaccatcgacgtctacatgatcatggtc
aagtgctggatgatagatgcagacagtcgcccaaagttccgtgagttgatccttgaattc
tccaagatggcccgagacccccagcgctaccttgtcatccagggggacgagagaatgcat
ttgccaagccccacggactccaacttttaccgcgccctgatggatgaggaggacatggag
gacgttgtggatgctgacgagtacctcgtcccccagcagggcttcttccacagccccgcc
acctcctggacaccgctcctcagctccctgagcacctccagcaacactcccactgtgact
tgcgttgatagaaatgggagctaccctctcaaggaagacagtttcttgcagcgctacagc
tcagaccccactggtgccctcatcgaggacagcatggacgacgctttcctcccagtacct
gaatatgtaaaccagtctgttcccaaaagacccgcaggctctgtccagaaccctgtctat
cacaatcagcctctatatccagctcctggcagagaccctcaataccaaaattcacgcagc
aacgccgtggacaaccctgagtatctcaacaccacccatcctgcctgtatcaatggtgta
ctcgatggccctgccctctgggctcagaagggcagtcaccaaattagcctagacaaccct
gactaccagcaggccttctttcccaaggaagccaagtcgaatggcatctttaaggggcct
gcagctgaaaatgcagagtacctgcgggcagcaccagcaggcagtgactttactggggcc
tga

DBGET integrated database retrieval system