KEGG   Bubalus bubalis (water buffalo): 112577629
Entry
112577629         CDS       T05912                                 

Gene name
CDKN2D
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112577629 (CDKN2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112577629 (CDKN2D)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 112577629
NCBI-ProteinID: XP_025149306
LinkDB
Position
9
AA seq 166 aa
MLLEEVHAGDRLSGAAARGDVQEVRRLLHRELVHPDVLNRFGKTALQVMMFGSPTIALEL
LKQGASPNVQDASGTTPAHDAARTGFLDTLKVLVEHGADVNAPDGTGALPIHLAVREGHT
SVVSFLATESDLHHRDARGLTPLELARGRGAQELMDILQRHTVAPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atgctgctggaagaggtccacgccggcgaccggctgagcggggcggcggcccgaggagac
gtgcaggaggtgcgccgccttctgcaccgcgagctggtgcacccagacgttctgaaccgc
tttggcaagactgcgctgcaggtcatgatgttcggcagtcccaccattgccctggaactc
ctgaagcaaggcgccagccccaacgtccaggatgcctcgggcaccactccggcccacgat
gcagcccgcactggattccttgacaccctaaaagtgttggtggagcacggcgctgatgtc
aacgcacccgatggcaccggggcgctccccatccacctggcagtgagagagggccacact
tctgtggtcagcttcctggctaccgagtctgatctccatcacagggacgccagggggctc
acacccctagagctggcacgggggagaggggcccaagagctcatggacatactgcagcgg
cacacggtggcacccctgtga

DBGET integrated database retrieval system