KEGG   Bdellovibrio bacteriovorus W: BDW_08195Help
Entry
BDW_08195         CDS       T03036                                 

Definition
(GenBank) hypothetical protein
Organism
bbw  Bdellovibrio bacteriovorus W
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorein_N
Motif
Other DBs
NCBI-ProteinID: AHI06139
UniProt: W5WYA0
LinkDB All DBs
Position
complement(1714502..1715590)
Genome map
AA seq 362 aa AA seqDB search
MPQRFQFDASILNSVVGGHSAIDIPRLNIQTLEAASAFMQSYGFDINNEAHLEELWYYHR
RALVLMLEKLDVNDEDIPKEFLDQKSLGDIRKLLLYASSSAADERHHQKWACAILRCMHV
FVHAENDLFASFAEEIQAQILTPFQEGIRHDGTTHSIHLHSGDVNLKDIQLKAFEIKPMK
TSSSTVIKLLAKPDALAMRIFDKLGVRFVTNNLFDSFQVVRFLIRENVISFPHIMPDQSS
NNLYPLELFMEVCTELVQEMDHLTDEIIQKRFDERLAQLGDQAKFLRKENFFSGSDYRFI
KFIARKLIRVKTPGQGEFSFFYPYEVQIMDQSAHERILSGPSEHQADKERQRAAARKRLF
PE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaacgatttcagttcgatgcctctattctaaattccgttgtcggtggacattca
gccatcgacattcctcgtttaaatattcagactctcgaagcggctagtgcatttatgcaa
agctatggttttgatatcaataacgaggctcatcttgaagaactttggtattaccatcgt
cgcgctctggttttgatgctagagaagttagatgtaaatgatgaggatattcctaaagag
ttccttgatcaaaaaagtttaggggatattcgtaagctcttactctacgccagttcttcg
gcggcagatgagcgccatcatcagaagtgggcctgtgcaattcttcgctgtatgcatgtt
tttgtgcatgcggaaaacgatctcttcgcatcttttgctgaagaaattcaagcgcagatt
ctgacgccttttcaggaaggtattcgtcatgatggaacgactcatagtattcatctgcac
agtggtgacgtaaatctcaaagatattcaactgaaggcttttgagatcaagccaatgaag
acctcctctagcaccgttataaagttattggcgaaacccgatgctttagcgatgcgtata
tttgataaactaggtgtacgttttgttacaaataatctctttgattcgtttcaagttgta
cgctttttgattcgcgagaatgtcattagcttcccgcatatcatgcctgatcagagttca
aataatctgtatccactcgagctttttatggaagtctgcacggagttggtgcaggagatg
gatcatctgacggacgaaattattcaaaagcgttttgatgaaagattggcgcaattagga
gatcaggcaaagtttctccgtaaagaaaattttttctcaggatctgactatcgctttatt
aagtttattgcgcgtaaactcattcgcgttaaaactcctgggcaaggggagtttagtttc
ttctatccctatgaagtgcagatcatggatcagtcggcccacgaaagaattctttcaggc
ccatctgaacatcaagcagataaggaaaggcaaagggcggctgcgcgcaagcgtctgttc
cctgagtag

DBGET integrated database retrieval system