KEGG   Burkholderia cepacia DDS 7H-2: DM42_1907Help
Entry
DM42_1907         CDS       T03302                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K13979  uncharacterized zinc-type alcohol dehydrogenase-like protein [EC:1.-.-.-]
Organism
bced  Burkholderia cepacia DDS 7H-2
Brite
KEGG Orthology (KO) [BR:bced00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM42_1907
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     DM42_1907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIO47224
UniProt: A0A095DSA7
LinkDB All DBs
Position
1:complement(2072325..2073377)
Genome map
AA seq 350 aa AA seqDB search
MSTTYAYAATDAQSPLAPFEFQRRALRDLDVQIDVLYCGVCHSDLHQARNEWRNTIYPVV
PGHEIVGRVSATGPQVSRFKVGELVGVGCLVDSCRTCASCEEGLEQYCENGFVGTYNGQD
RVTGDITYGGYSTQLVVDEAFVLRVPDTLDPAGAAPLLCAGITTYSPLRQWNVGPGKKVG
IVGLGGLGHMGVKLARAMGAHVVLFTTSPSKIEDGKRLGAHEVVISKDEAQMNAHLNSFD
FILNTVAAQHDLNPFLNLLKRDGTMTLVGAPEHDHPSPQVFNLIFKRRRLAGSLIGGIAE
TQEMLDFCAEHGITSDIETIPMQQINTAYERMLKSDVKYRFVIDMASLRQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgacctatgcctacgcggcgaccgatgcgcagtcgccgctcgccccgttcgaa
ttccagcgtcgcgcgctgcgcgacctcgacgtccagatcgacgtcctctactgcggcgtc
tgccactcggatcttcaccaggcgcgcaacgaatggcgcaacacgatctacccggtcgtc
cccggccatgaaatcgtcggccgcgtgagcgcgaccggcccgcaggtgtcgcgcttcaag
gtcggcgagctggtcggcgtcggctgtctcgtcgattcgtgccgcacctgcgcgagctgc
gaagaaggcctcgagcagtattgcgagaacggcttcgtcggcacctacaacggccaggac
cgcgtgacgggcgacatcacgtacggtggctattcgacgcagctcgtcgtcgacgaggcg
ttcgtgctgcgcgtgccggacacgctcgacccggccggcgcggcgccgctcctgtgcgcg
gggatcacgacctattcgccgctgcggcagtggaacgtcggccccggcaagaaggtcggc
atcgtcggtctcggcggcctcggccacatgggtgtgaagctggcgcgtgcgatgggcgcg
cacgtcgtgctgttcacgacgtcgccgtcgaagatcgaggacggcaagcggctcggcgcg
cacgaagtcgtgatctcgaaggatgaagcgcagatgaacgcgcacctgaacagcttcgac
ttcatcctgaacacggtcgccgcgcagcacgacctgaatccgttcttgaacctgctcaag
cgcgacggcacgatgacgctcgtcggcgcgccggagcacgaccatccgtcgccgcaggtg
ttcaacctgatcttcaagcgccgccgcctcgcgggttcgctgatcggcgggatcgcggaa
acgcaggaaatgctcgatttctgcgcggaacacgggatcacgtccgatatcgagacgatt
ccgatgcagcagatcaacacggcctacgagcggatgctgaagagcgacgtgaagtaccgg
ttcgtgatcgacatggcgtcgctcaggcagtaa

DBGET integrated database retrieval system