KEGG   Burkholderia cepacia DDS 7H-2: DM42_3060Help
Entry
DM42_3060         CDS       T03302                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00473  D-Alanine metabolism
bced01100  Metabolic pathways
bced01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DM42_3060 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    DM42_3060 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bced01011]
    DM42_3060 (alr)
Enzymes [BR:bced01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DM42_3060 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bced01011]
 Precursor biosynthesis
  Racemase
   DM42_3060 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIO49969
UniProt: A0A095DW04
LinkDB All DBs
Position
1:3301523..3302593
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRFAGPSKVWAVVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYVPEKYRAAWERARACPGIGQITLMTHFSDADNERGVAEQLATFERGA
ENIAGARSLANSAAVLWHPDTHFDWVRPGIVLYGASPSGLSSDIADTGLKPAMTLASELI
AVQTIAKGQAIGYGSTFSAQAPMRIGVVACGYADGYPRVAPEGTPVIVDGIRTRIVGRVS
MDMITVDLTPCPQAGVGARVELWGNALPIDDVARHCGTIGYELMCAVAGRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccacaccgccgctctcgcgaacaatctctccgtc
gtccgccgctttgccggcccgtccaaggtctgggcggtcgtcaaggccaacgcgtacggc
cacggtctcgcccgcgtgtttccgggcctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgagctcggctgggccggcccgatcctgctgctcgaa
ggcttcttccgctcgaccgacatcgacgtgatcgaccgctacagcctgaccacgaccgtc
cacaacgacgagcagatgcggatgctggaaacggcgcggctgtcgaagcccgtcaacgtg
cagctcaagatgaacagcgggatgaaccggctcggttacgtgccggagaaataccgcgcc
gcgtgggagcgcgcccgcgcgtgccccggcatcggccagatcacgttgatgacccatttt
tcggacgcggacaacgagcgcggcgtcgccgagcagctcgcgacgttcgagcgcggcgcg
gaaaacatcgccggcgcgcgcagcctcgcgaattcggcggccgtgctgtggcatccggat
acgcacttcgactgggtgcggccggggatcgtcctgtatggcgcgtcgccgtccgggctg
tcgtccgatatcgcggataccgggctgaagccggcgatgacgctcgcgtccgagctgatc
gcggtgcagacgatcgcgaagggccaggcgatcggctatggctcgacgttttccgcgcag
gcgccgatgcggatcggcgtggtcgcgtgcggttacgcggacggctatccgcgcgttgcg
ccggaaggcacgcccgtgatcgtcgacggcatccgtacgcggatcgtcggtcgcgtgtcg
atggacatgatcaccgtcgacctgacgccgtgcccgcaggccggcgtcggcgcgcgggtc
gaactgtggggcaacgcgctgccgatcgacgacgtcgcgcgccattgcgggacgatcggc
tacgagctgatgtgcgcggtcgccggccgcgtgccggtgcgagcggaataa

DBGET integrated database retrieval system