KEGG   Burkholderia cepacia DDS 7H-2: DM42_5154Help
Entry
DM42_5154         CDS       T03302                                 

Definition
(GenBank) hypothetical protein
Organism
bced  Burkholderia cepacia DDS 7H-2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIO46656
UniProt: A0A095FAR0
LinkDB All DBs
Position
2:1791728..1792060
Genome map
AA seq 110 aa AA seqDB search
MNVDYLFYRKPNKPGPYSLDDLGDIAPPIGPGDVVRAGIARVFEQIDWQESPDVPGAWFG
TGGAVFQFTAEPDGRVTSFMGSRLERRSMLQLTREMGLIALDLQRDIVYG
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgactatctcttctatcggaagccgaacaaacccggcccctattcgctcgac
gacctgggcgacatcgcgccgccgatcggcccgggcgacgtggtgcgggcgggcatcgcg
cgcgtgttcgagcagatcgactggcaggaatcgcccgacgtgccgggcgcgtggttcggc
accggcggcgcggttttccagttcaccgccgagcccgacggccgcgtgacgagcttcatg
ggctcgcgcctcgagcgccgctcgatgctgcagctcacgcgcgaaatgggactcatcgcg
ctcgatctgcagcgcgacatcgtctacggctga

DBGET integrated database retrieval system