KEGG   Burkholderia cenocepacia H111: I35_6458Help
Entry
I35_6458          CDS       T03804                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00250  Alanine, aspartate and glutamate metabolism
bceo00410  beta-Alanine metabolism
bceo00640  Propanoate metabolism
bceo00650  Butanoate metabolism
bceo01100  Metabolic pathways
bceo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    I35_6458
   00650 Butanoate metabolism
    I35_6458
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I35_6458
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I35_6458
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bceo01007]
    I35_6458
Enzymes [BR:bceo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     I35_6458
Amino acid related enzymes [BR:bceo01007]
 Aminotransferase (transaminase)
  Class III
   I35_6458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CDN64294
LinkDB All DBs
Position
2:2812781..2814064
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIADQLNSFTHTAYQIVPYASYVELAEKINDRAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEFLK
PGSGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgccgcccgcgccgagaacgcggagctgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatcgcggatcaactgaacagcttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgagctggcggaaaagatcaacgaccgcgcgccgggcgacttc
ccgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgagaacgcgatcaagatc
gcgcgtgcggcgaccggccgtccgggcgtgatcgcattctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcactgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgaattc
gtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgacgaagtg
cagacgggcttcgcacgtaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacgtgatggacgcggccgcccccggcggcctcggcggcacctacgcgggcaac
ccgctggcggtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gagcgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaacgcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgaattcctgaag
ccgggttcgggcgagccggatgccgaattcacgaagcgcgtgcaggcgcgtgcgctcgag
cgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcccgcaagccgtgttcgacgaagcgctcgtgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system