KEGG   Burkholderia cepacia ATCC 25416: APZ15_27875Help
Entry
APZ15_27875       CDS       T04772                                 

Definition
(GenBank) 2,2-dialkylglycine decarboxylase
  KO
K00596  2,2-dialkylglycine decarboxylase (pyruvate) [EC:4.1.1.64]
Organism
bcep  Burkholderia cepacia ATCC 25416
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcep01007]
    APZ15_27875
Enzymes [BR:bcep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.64  2,2-dialkylglycine decarboxylase (pyruvate)
     APZ15_27875
Amino acid related enzymes [BR:bcep01007]
 Aminotransferase (transaminase)
  Class III
   APZ15_27875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALK21562
LinkDB All DBs
Structure
PDB: 

Position
2:complement(2367213..2368514)
Genome map
AA seq 433 aa AA seqDB search
MSLNDDPTFWRNARQHLVRYGGTFEPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHS
HPEIVSVIGEYAGKLDHLFSGMLSRPVVDLATRLADITPDGLDRALLLSTGAESNEAAIR
MAKLVTGKYEIVGFAQSWHGMTGAAASATYSAGRKGVGPAAVGSFAIPAPFTYRPRFERN
GTYDYLAELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELPEGYMAALQRKCEERGMLL
ILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLF
YTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLL
LGVEIVKDRRTKEPADGLGAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVSEEEIDL
GLALLGQAIERAL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaacgacgacccgaccttctggcgcaacgccaggcagcacctggtccgctac
ggcggcacgttcgagccgatgatcatcgagcgcgcgaaaggcagcttcgtctacgacgcc
gacggccgcgcgatcctcgatttcacgtcggggcagatgagcgcggtgctcggccacagc
catccggagatcgtctccgtgatcggcgaatacgcgggcaagctcgaccatctgttcagc
gggatgctgtcgcggccggtcgtcgacctcgcgacgcgcctcgccgacatcacgcccgac
gggctcgatcgcgcgctgctgctcagcaccggcgcggaatcgaacgaagcggcgatccgg
atggcgaagctcgtcaccggcaagtacgagatcgtcggcttcgcgcagtcgtggcacggg
atgacgggcgccgccgcatcggccacgtacagcgccggccgcaagggcgtcggcccggcc
gccgtcggctcgttcgcgattcccgcaccgttcacctaccggccgcgcttcgagcgcaac
ggcacgtacgactatctcgccgaactcgactacgcgttcgacctgatcgaccgccagtcg
agcggcaacctcgccgcgttcatcgcggagccgatcctcagttcgggcgggatcatcgag
ctgccggaaggctatatggcggcgctccagcgcaagtgcgaggaacgcgggatgctgctg
atcctcgacgaagcgcagacgggcgtcgggcgcaccggcacgatgttcgcgtgccagcgc
gacggcgtgacgcccgacatcctgacgctgtcgaagacgctcggcgcggggctgccgctc
gcggcgatcgtgacgtccgcggcgatcgaggaacgcgcgcacgaactcggctacctgttc
tacacgacgcacgtgtcggacccgctgccggcggccgtcggcctgcgcgtgctggacgtg
gtgcagcgcgacgggctcgtcgctcgagcgaacgtgatgggcgaccggctcaggcgcggt
ctgctcgacctgatggagcgtttcgactgcatcggcgacgtgcgcggacgcgggctgctg
ctcggtgtcgagatcgtcaaggatcgccggacgaaggaaccggcggacgggctcggcgcg
aagatcacgcgcgaatgcatgaacctcgggctcagcatgaacatcgtgcagttgccaggc
atgggcggcgtgttccggatcgcgccgccgctgaccgtcagcgaggaagagatcgatctc
ggcctggcgctgctggggcaggcgatcgaacgggcgttgtga

DBGET integrated database retrieval system