KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_093
Entry
AB162_093         CDS       T04544                                 

Gene name
dnaX
Definition
(GenBank) DNA polymerase III subunits gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_093 (dnaX)
   03430 Mismatch repair
    AB162_093 (dnaX)
   03440 Homologous recombination
    AB162_093 (dnaX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_093 (dnaX)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_093 (dnaX)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_093 (dnaX)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_093 (dnaX)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_093 (dnaX)
SSDB
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA RuvB_N AAA_5 AAA_22 AAA_14 TIP49 AAA_16 AAA_24 ResIII AAA_7 AAA_30 AAA_18 AAA_19 Mg_chelatase PIF1 TsaE DNA_pol3_delta ABC_tran DUF815 SKI Rad17 AAA_28 AAA_2 Sigma54_activat CbiA VirE
Other DBs
NCBI-ProteinID: AKZ65714
UniProt: A0A0K2BKJ9
LinkDB
Position
107133..108275
AA seq 380 aa
MSYQVLARKWRPQNFSEVVGQEHVITALTNSLVLGRIHHSYLLSGTRGVGKTTIARLLAK
CLNCEKGITTIPCSECKSCREITNNCFVDFIEIDAASSSKVEDTREILDHIQYVPTNGRF
KIYLIDEVHMLSRHSFNALLKTLEEPLAHIKFLLATTDPQKIPLTILSRCLQFHLTTLNI
NQICNQLSKILTAEKINTEQRALKLIARAAYGSMRDALSITDKAIAIGQGIVSVEAVSVM
LGTINTEQSLALIEALVNKNGSNMMKQLAKCAELGINWDNLLVDILSILHRIALAQIVPE
TKYYDDYLNNKLIPNILNLTKMISPEDIQLFYQIILIGRKELPYAPDQRMGVEMTMLRAL
AFHPVSINQTSFSAAYINNN
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgagctatcaggtacttgcacgtaagtggcgtccacaaaacttttctgaagtcgtcggt
caagaacatgttattactgcgctgactaatagtttggtgttaggaagaattcatcattca
tatctattatctggtactcgcggagtaggtaaaacaactattgcacgcttactagctaaa
tgtttaaattgtgaaaaagggataactactattccatgtagtgagtgtaaaagttgccgt
gaaattacaaataattgttttgttgatttcattgagatagatgctgcctcaagcagcaag
gtagaagatactcgtgaaattttagatcatatacagtatgtccccacaaacggtcgtttc
aaaatatacctaatcgacgaagtacatatgttatctagacatagttttaatgcgctgcta
aaaactctagaagagcctcttgcacatattaaatttctgctagctactactgatccacaa
aagatacctcttactattttgtcaagatgtctacaatttcatctaactactcttaatatt
aaccaaatatgtaaccagttaagtaaaatattaactgctgaaaaaattaataccgaacag
cgtgcattaaaactaatagcacgtgcagcatatggtagtatgcgtgatgcactaagtatt
actgataaagctattgctattggtcaagggatagtaagtgtagaagctgttagtgtaatg
cttggtactattaatacagaacaatcattagcattaatagaagcattagtaaataaaaat
ggttcaaatatgatgaaacagctagctaaatgtgcagaactaggtattaactgggacaat
ttattagtcgatatattatctattctacatcgtattgctttagctcagatagtccctgag
acaaaatactatgatgattatcttaataataaacttatacctaatatacttaatttaaca
aaaatgatttcaccagaagatatacaactattttatcaaattattctaattggtcgcaaa
gaactaccttatgcgccagatcagcgaatgggggtagaaatgactatgttgcgtgcgcta
gcttttcaccctgtatcaataaaccaaacatcattttcggctgcatatatcaataataat
tga

DBGET integrated database retrieval system