KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_258
Entry
AB162_258         CDS       T04544                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB162_258 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_258 (ruvA)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AB162_258 (ruvA)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AB162_258 (ruvA)
    RecFOR pathway proteins
     AB162_258 (ruvA)
SSDB
Motif
Pfam: HHH_5 RuvA_N HHH RuvA_C DUF655 IMS_HHH Transposase_20 HHH_3 5_3_exonuc
Other DBs
NCBI-ProteinID: AKZ65859
UniProt: A0A0K2BKY0
LinkDB
Position
complement(283721..284335)
AA seq 204 aa
MIGRIRGIIIEKQPPLILLEIYGIGISYEVYMPITSFDGLPGIGQEVTLYTHCIVREDIK
ILFGFFKKNEIILFRELIKVNGVGPKLALAIISGMSEKEFYSAVANNEINTLIKLPGVGK
KTAERLLVEMKDRFKNTYKTFLSIGELPDFTDNKKEAIAALISLGYTYNNASQMVNKVAQ
SSIGSNCETLIIKALRTTILGEND
NT seq 615 nt   +upstreamnt  +downstreamnt
gtgattggacgtataagaggcataattatagaaaaacagccgccactaatattattagaa
atatacgggataggtataagttatgaagtgtatatgcctataacatcttttgatggatta
ccgggaattggtcaagaagttaccctatatactcattgtattgtacgcgaagatataaaa
attttatttggtttttttaaaaaaaacgagattatactatttcgggaactaattaaagtt
aatggtgttggacccaaactagcgttagctattatttctggtatgtcagaaaaagaattt
tatagcgcagtagcaaataacgaaattaatactctaattaaattaccaggagttggtaaa
aaaacagcagaacgtcttttagtagaaatgaaagacagatttaaaaatacctataaaaca
ttcctatctataggagaattaccagattttacagataataaaaaagaagcgatcgcagca
ctaatttccctaggttatacctataataacgctagccaaatggttaacaaggtagctcaa
tctagtataggatctaactgtgaaacattaataataaaggcattacgcacaactatatta
ggagaaaatgattga

DBGET integrated database retrieval system