KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_422
Entry
AB162_422         CDS       T04544                                 

Gene name
rnhA
Definition
(GenBank) Ribonuclease HI
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_422 (rnhA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_422 (rnhA)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     AB162_422 (rnhA)
DNA replication proteins [BR:bcig03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    AB162_422 (rnhA)
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     AB162_422 (rnhA)
   Elongation factors (archaeal)
     AB162_422 (rnhA)
SSDB
Motif
Pfam: RNase_H RVT_3
Other DBs
NCBI-ProteinID: AKZ66010
UniProt: A0A0K2BL05
LinkDB
Position
433769..434248
AA seq 159 aa
MHNKVEIFTDGSCLSNPGPGGYGVILRYKNYEKECSAGFRLTTNNRMELMAIIVALELLR
YPCEVLIYLDSQYVHQGMMQWIYNWKKDNWKNTKKNIKNCDLWQRFDIASQSHIINSFWL
KSHTGHPENERCDYMARAAAKKPYLEDVGYKTTIITTIR
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcataataaggtagagatttttaccgatggttcatgtcttagtaatcctggtcctggt
ggatatggcgtgatattacgttataaaaattatgaaaaagaatgcagcgctggtttcagg
ttaacaactaataatcgtatggaactaatggcaataattgtagcattagagttattaaga
tacccttgtgaggtattaatctacctagatagtcagtatgttcatcaaggtatgatgcaa
tggatatataattggaaaaaagataattggaagaatactaaaaaaaatataaaaaattgt
gatttatggcaaagatttgatatagcaagtcaatcacatataataaattctttttggtta
aaaagtcatactggtcatccagaaaatgaacgttgtgattacatggctcgtgcagcagca
aaaaaaccatatttagaagatgttgggtataaaactactataataacaactataagatga

DBGET integrated database retrieval system