KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_520
Entry
AB162_520         CDS       T04544                                 

Gene name
priN
Definition
(GenBank) Primosomal replication protein N
  KO
K02686  primosomal replication protein N
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB162_520 (priN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_520 (priN)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AB162_520 (priN)
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-ProteinID: AKZ66100
UniProt: A0A0K2BLA4
LinkDB
Position
complement(547332..547643)
AA seq 103 aa
MKANHLMLSGTVCKTPISKVSPSGIKHYQFVIEHRSVQNEAGFIRQAWCRVPVVVSSSIL
SNNITNNITVGDKITVHGFICSHKGRNGLRKIVLHAEHIYLID
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaaggctaatcacctgatgttatcaggcacagtttgcaagacccctattagtaaagta
agtccatctgggataaaacattatcaatttgttattgagcatcgttctgtacagaatgaa
gctggttttatacgacaggcatggtgtagagtacctgtagtagtaagtagcagcatacta
tcaaataatattacgaataatatcacagtgggcgataaaattaccgtacacgggtttata
tgtagtcataaaggacgtaatggacttagaaaaattgtattgcatgctgaacatatttat
ttaatagattag

DBGET integrated database retrieval system