KEGG   Bacillus circulans: C2I06_04300
Entry
C2I06_04300       CDS       T06357                                 

Definition
(GenBank) PTS mannose transporter subunit IIA
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bcir  Bacillus circulans
Pathway
bcir00051  Fructose and mannose metabolism
bcir02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bcir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C2I06_04300
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    C2I06_04300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcir02000]
    C2I06_04300
Enzymes [BR:bcir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     C2I06_04300
Transporters [BR:bcir02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    C2I06_04300
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: AYV66160
UniProt: A0A268FIT6
LinkDB
Position
949915..950328
AA seq 137 aa
MKNIVILSHQGVASGLKRSAQMIVGEFNPLITIELTEMGVETFTNEVQQFLQNEVIDKQK
EYLAFVDLKGGTPYNQIVKETLRLNLADKVRIISGVNLPLILEAFYFEEDDLTILEKKGK
RAIEFCQLEMNVSNLDE
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaaaaatattgttatactttctcatcaaggcgttgcatcagggttgaaaagatctgca
caaatgatagtaggagaattcaaccctctcataacaattgaattaacagaaatgggtgta
gaaacttttacgaatgaagtacagcagtttctgcaaaatgaggtcatagataaacaaaag
gaatatttagcctttgttgatttaaaggggggcaccccctataaccaaattgtaaaggaa
acattgagattaaaccttgctgataaggtgagaattatctcaggtgttaatttaccatta
attttagaagcgttttatttcgaagaggatgatctgaccattttagagaaaaaaggaaaa
agagcaattgaattttgtcagttggaaatgaatgtatctaatttagatgaatag

DBGET integrated database retrieval system