KEGG   Bacillus circulans: C2I06_17920Help
Entry
C2I06_17920       CDS       T06357                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcir  Bacillus circulans
Brite
KEGG Orthology (KO) [BR:bcir00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2I06_17920
Enzymes [BR:bcir01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C2I06_17920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like FAD_binding_3 DAO Thi4 AlaDh_PNT_C NAD_binding_7 Glutaredoxin K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AYV68601
UniProt: A0A268FFR8
LinkDB All DBs
Position
3763484..3765013
Genome map
AA seq 509 aa AA seqDB search
MLLDNEIKGQLNQYLQMMEGDVVLKVSTGSDEVSRDMLALVDELATMSSHIKVETAELER
TPSFSVNRVGEDTGITFAGIPLGHEFTSLVLALLQVSGRAPKVDQKVIDQIKAIKGEFHF
ESYISLTCHNCPDVVQALNVMSLINPGITHTMIDGAAFKEEVESKDIMAVPTVFLNGESF
GSGRMSLEEILAKMGSAADASEFADKDPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQIMDTLAIENFISVKQTEGPKLAASLEEHVKEYNIDVMNLQRAKRLEKKDLIEIELE
NGAVLKSKSVILSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFTGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMSELKADSVLQERLNSLPNVTVLKNVQTKEITGTDKVNGITY
VERETGEEKHIELAGVFVQIGLVPNTDWLEGTVERNRMGEILVDKHGATSLPGVFAAGDC
TDSAYKQIIISMGSGATASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttactagataatgaaattaaagggcaactgaatcaatatctgcaaatgatggaaggc
gatgttgttcttaaggttagcacgggatcggatgaagtatcccgtgacatgctagcccta
gttgatgaactagctactatgtcatctcatatcaaagtagaaactgctgaattagaaaga
acaccaagttttagtgtaaatcgtgttggcgaagatactggaattacttttgctggtatc
cctctaggacacgaattcacttctttagtattagctttacttcaagtaagtggtagagct
cctaaagtcgatcaaaaagtaatcgatcaaattaaagcaatcaaaggtgaattccacttt
gaatcttacattagcttaacttgccataactgtccggatgtagtacaagcgttgaatgtg
atgagtcttataaaccctggtatcacacatacaatgattgatggggcagcttttaaggaa
gaagtagaaagcaaagatatcatggcagttcctactgttttccttaatggggaatcattt
ggcagcggtcgtatgtcattagaagaaattttagcaaaaatgggcagcgctgctgatgct
tctgaatttgctgataaagatccatttgatgtattagtagttggcggtggtccggctggt
gcaagtgctgcaatctacgctgcacgtaaaggaatccgcactggtatcgttgcagaacgc
ttcggtggccaaatcatggatacgttagctattgaaaacttcattagtgtgaagcaaaca
gaaggtccaaagcttgcagcaagtctggaagagcatgtaaaagaatataacattgacgtt
atgaaccttcaacgtgctaaacgtttagagaaaaaagacttaatagaaatcgagttagaa
aatggtgctgttctgaaaagtaagtctgttattctatcaactggtgctcgctggcgcaat
gttggcgtaccgggagaagcagaatttaagaacaaaggtgtagcatattgtcctcactgt
gatggtccattatttactggaaaagacgttgctgtaatcggcggcggtaactcaggaatt
gaagctgctatcgacttagcaggaattgtgaaacacgtaacagttcttgaatttatgtcg
gaattaaaagcagactctgttttacaagagcgcttaaacagcctaccaaatgttacagtt
ctgaaaaatgttcaaacaaaagaaataactggtactgataaagttaacggtattacttat
gttgaacgcgaaactggcgaagaaaaacatatcgagcttgcaggtgtgtttgtccaaatt
ggtctagttcctaatacagactggttagaaggtacagtggagcgtaacagaatgggtgaa
attcttgttgataagcatggcgctacaagtctgccaggtgtatttgcagctggagattgt
acagacagcgcttataagcaaatcattatttccatgggttctggtgcaactgcttcatta
ggtgcatttgattatctgatccgtaattaa

DBGET integrated database retrieval system