KEGG   Burkholderia cenocepacia J2315: BCAL0995
Entry
BCAL0995          CDS       T00771                                 

Gene name
acpP2
Definition
(GenBank) acyl carrier protein (ACP) 2
  KO
K02078  acyl carrier protein
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00998  Biosynthesis of various secondary metabolites - part 2
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BCAL0995 (acpP2)
SSDB
Motif
Pfam: PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493
Other DBs
NCBI-ProteinID: CAR51302
UniProt: B4EAI3
LinkDB
Position
1:1083131..1083370
AA seq 79 aa
MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA
EKITTVQQAIDYARANVKA
NT seq 240 nt   +upstreamnt  +downstreamnt
atggacaacatcgaacaacgtgtcaagaagatcgtcgctgaacaactgggcgtcgcggaa
gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgcggactcgctcgacacg
gtcgaactggtgatggctctcgaagacgagttcggcatggaaatcccggacgaagaagca
gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system