KEGG   Burkholderia cenocepacia J2315: BCAM2493
Entry
BCAM2493          CDS       T00771                                 

Definition
(GenBank) putative NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K00206  phosphonoacetaldehyde dehydrogenase [EC:1.2.1.-]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00440  Phosphonate and phosphinate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BCAM2493
Enzymes [BR:bcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BCAM2493
SSDB
Motif
Pfam: Aldedh pPIWI_RE_Y Trm56
Other DBs
NCBI-ProteinID: CAR56358
UniProt: B4EJ46
LinkDB
Position
2:complement(2828768..2830219)
AA seq 483 aa
MAHPRQDHPSFRAEALRWCGTRAMRERTLDVTDPYTGTRVGTAPLASVDDVRAAFDYAMA
YRPTLTRYERSQILERAAALLRERTEEASDLITLESGLSKQDSRYEIGRVADVLKFAAVE
ALRDDAQSFSCDLTPHGKARRVFSQRQPLDGVIVAITPFNHPMNQVAHKIAPAIATNNRV
IVKPSEKVPLSAFYLADLLYEAGLPEPMLQVLTGDPAEIADELVTHPHASLITFTGGVAI
GKAIAARAGYRRIVLELGGNDPLIVLADADPDRAASLAVLGSYRNSGQRCTAVKRMLVQR
SIVPAFTELLVEKTRAWKYGDPFDPSNEMGTVIDEAAARLFEARVNEAVAQGARLLTGNV
RRGALYAPTVLDNVDPSMTLVREETFGPVSPVIAFDTIDDAIRLSNGTAFGLSSGVCTDS
TAAVVRFVNELNVGTVNVWEVPGYRIELSPFGGIKDSGLGYKEGVQEAMKSFTNLKTFSL
PWE
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggctcatccgcggcaagatcatccgtcgtttcgtgccgaagcgttgcgttggtgcggc
acgcgcgcgatgcgcgagcgcacgctcgacgtcacggacccgtacacgggcacgcgcgtc
ggcaccgcgccgctcgccagcgtcgacgacgtgcgtgcggcgttcgattacgcgatggcc
taccggccgacgctgacgcgctacgaacgctcgcagattctcgaacgtgcggccgcgctg
ctgcgcgagcgcaccgaggaggcgtccgacctgatcacgctcgagtcggggttgtcgaaa
caggattcgcgctacgagatcggccgggtggccgacgtgctgaagttcgcggcggtcgag
gcgctgcgtgacgatgcgcagagtttctcttgcgacctgacgccccacggcaaggcgcgg
cgcgtgttctcgcagcgccagccgctcgacggcgtgatcgtcgcgattacgccgttcaat
catccgatgaaccaggtcgcgcacaagatcgcgccggcgatcgcgaccaacaaccgcgtg
atcgtgaagccgtcggagaaggtgccgctgtcggcgttctatctggccgacctgctgtat
gaagccgggctgccggaaccgatgctgcaggtgttgaccggcgacccggccgagatcgcg
gacgagctcgtcacgcatccgcatgcgtcgctgatcacgttcacgggcggcgtcgcgatc
ggcaaggcgattgcggcgcgggccggctaccggcgcatcgtgctggagctgggcggcaac
gatccgctgatcgtcctcgccgatgccgatcccgaccgcgcggcgtcgctcgcggtgttg
ggctcgtaccggaattcgggccagcgctgcacggccgtcaagcggatgctggtgcagcgc
tccatcgtgccggcgttcaccgaattgctcgtcgagaagacgcgcgcctggaaatatggc
gatccattcgatccctcgaacgaaatgggcacggtgatcgacgaagccgcggcgcggctg
ttcgaggcgcgcgtgaacgaggcggtcgcgcagggcgcgcgcctgctgacgggcaatgtg
cggcgcggcgcgttgtacgcgccgaccgtgctcgacaacgtcgatccgtcgatgacgctg
gtgcgcgaggagaccttcgggcccgtgtcgcccgtcatcgcattcgatacgatcgacgac
gcgatccggctcagcaacggcacggcgttcgggctgtcgtcgggtgtctgtacggacagc
acggccgccgtcgtacggttcgtgaacgagttgaacgtcggcacggtgaacgtatgggaa
gtgcccggataccggatcgaactgtcgccgttcggcgggatcaaggattcggggctcggt
tacaaggaaggcgtccaggaggcgatgaagagtttcacgaacctgaagacgttttcgctg
ccttgggagtaa

DBGET integrated database retrieval system