KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4909Help
Entry
Bcenmc03_4909     CDS       T00669                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00250  Alanine, aspartate and glutamate metabolism
bcm00410  beta-Alanine metabolism
bcm00640  Propanoate metabolism
bcm00650  Butanoate metabolism
bcm01100  Metabolic pathways
bcm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcenmc03_4909
   00650 Butanoate metabolism
    Bcenmc03_4909
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcenmc03_4909
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcenmc03_4909
Enzymes [BR:bcm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bcenmc03_4909
Amino acid related enzymes [BR:bcm01007]
 Aminotransferase (transaminase)
  Class III
   Bcenmc03_4909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACA94039
UniProt: B1K565
LinkDB All DBs
Position
2:complement(1937608..1938891)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIADQLNNFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAVKI
ARAATGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEFLK
PGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgccgcccgcgccgagaacgcggagctgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatcgccgatcagttgaacaacttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgaactggcggaaaagatcaacgagcgtgcgccgggcgacttc
ccgaagaagacggcgttcttcacgaccggcgccgaagccgtcgagaacgcggtcaagatc
gcgcgcgcggcaaccggccgtccgggcgtcatcgcattcgcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgccgtgcacggcgtgacgaccgcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgaattc
gtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgacgaagtg
cagacgggcttcgcgcgcaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgggcggacgtgatggacgcggccgcccccggcggcctcggcggcacctacgcgggcaac
ccgctggcggtcgcctcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gagcgtgcgacgcaactcggcgacgtgctgaaggcgaagctgaatgcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgaattcctgaag
ccgggttcgggcgagccggatgccgaattcacgaagcgcgtgcagacgcgtgcgctcgag
cgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcccgcaagccgtgttcgacgaagcgctggtgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system