KEGG   Baudoinia panamericana: BAUCODRAFT_84800Help
Entry
BAUCODRAFT_84800  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
bcom  Baudoinia panamericana
Pathway
bcom04113  Meiosis - yeast
bcom04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    BAUCODRAFT_84800
  09143 Cell growth and death
   04113 Meiosis - yeast
    BAUCODRAFT_84800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bcom01001]
    BAUCODRAFT_84800
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bcom03019]
    BAUCODRAFT_84800
   03036 Chromosome and associated proteins [BR:bcom03036]
    BAUCODRAFT_84800
Enzymes [BR:bcom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     BAUCODRAFT_84800
Protein kinases [BR:bcom01001]
 Serine/threonine kinases: AGC group
  PKA family
   BAUCODRAFT_84800
Messenger RNA biogenesis [BR:bcom03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     BAUCODRAFT_84800
Chromosome and associated proteins [BR:bcom03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    BAUCODRAFT_84800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like bZIP_C
Motif
Other DBs
NCBI-GeneID: 19117417
NCBI-ProteinID: XP_007673798
JGI: Bauco1_84800
UniProt: M2NII8
LinkDB All DBs
Position
Unknown
AA seq 462 aa AA seqDB search
MPTLGFLKKKRTKDSQGSDSAAPTSPVADKAQHAAGSPLTPTISKGSTLFTEPESTKQQQ
QQQDTPTGMNAQAAGQLQGQNPTANTQNVPSIQHLINQPQYGGNSQPHDSGYSSTTDGST
GQNVPMLNLPQQKPVGNAVRETKGKYTLSDFQISRTLGTGSFGRVHLVQSKHNQRYYAVK
VLKKAQVVKMKQVEHTNDERRMLQRCKHPFLITLWGTWQDSKNLYMVMDFIEGGELFSLL
RKSQRFPNPVAKFYAAEVTLALDYLHSMNIIYRDLKPENLLLDRHGHLKITDFGFAKEVP
DITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIFEMLAGFTPFWDSGSPLKIYENIL
KGRVKYPPYIHPDAQDLLSKLITSDLTKRLGNLHGGSKDVMTHPWFAEVTWDRLAKKDID
APYVPPVRAGVGDASLFDKYPEETEAYGAAGDDAYGKLFPDF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccctcggcttcctcaagaagaaacgtacaaaggactcgcaagggtccgactcc
gcagcgcccacctcgcccgtcgcggacaaggcacagcacgctgcgggctcacctctcaca
ccaaccatctcaaaaggtagcactctgtttaccgagccagagtccaccaaacagcagcag
cagcagcaggacacgccaacgggtatgaacgctcaagcggccggacagctgcaagggcag
aacccgaccgcgaacacgcagaatgtaccctcgatccagcacctgataaatcagccgcag
tatggcggcaactcacaaccgcacgactccggctactccagcaccaccgacggcagtacc
ggtcagaacgtgcccatgcttaacctacctcagcagaagccagtcggaaatgcagtgaga
gagacgaaaggaaagtatacactcagtgactttcagatcagccgcacgctaggcactgga
tctttcggtagagtgcatctagtgcagagcaagcacaaccagcggtactatgccgtgaag
gtgctcaagaaggcgcaggttgtgaagatgaagcaggtcgagcacacgaacgacgaacgg
cgaatgcttcaacgatgtaagcatccgttcctgattacgctatggggtacatggcaagac
agcaagaacttgtatatggtcatggacttcattgagggtggcgagctgttcagtctgctg
cgtaaaagtcagcgctttccaaatccagtagccaagttttatgctgccgaagtcacacta
gcgctggactacctacacagcatgaatatcatataccgcgatctcaagccagagaatctg
ttacttgaccgacacggacatctcaagatcaccgacttcggcttcgcgaaggaggtaccc
gacatcacctggactctctgcggtacacccgactacctcgcgccagaagtcgtaagcagc
aaaggctacaataaatcggtcgactggtggagtcttggtatcctcatcttcgagatgttg
gctggcttcacacccttctgggattccggctcgccactcaagatctacgagaacatcttg
aaagggcgcgtgaagtacccaccgtacattcatccagatgcacaggatctgctcagcaag
ctcatcacgtccgacttgacgaagcgactgggtaacttgcatggcggcagcaaggacgtc
atgacgcacccttggttcgcggaggtgacgtgggatcggttggcgaagaaggatattgat
gcaccgtatgtgccgccggtgagggctggcgtcggtgatgcgagtttgtttgacaagtat
ccggaggaaacggaggcttacggtgcggctggtgacgatgcatacggcaagctgttccca
gatttctag

DBGET integrated database retrieval system