KEGG   Burkholderia contaminans: NL30_06370Help
Entry
NL30_06370        CDS       T03969                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00440  Phosphonate and phosphinate metabolism
bcon01100  Metabolic pathways
bcon01120  Microbial metabolism in diverse environments
bcon01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    NL30_06370
Enzymes [BR:bcon01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     NL30_06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AKM39547
UniProt: A0A0G3YQ43
LinkDB All DBs
Position
1:1475692..1477377
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAADRLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVERLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGAGNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaatggcctgtccgcgcggatcgtc
cgcgaagccggcttcaagggcatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgtgacaacaacgaagccagctggacccaggtcgtcgacgtgctcgaattcatggcg
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtctgtatcgaggac
aagcagttcccgaagaccaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgtgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcatacgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgg
ccggacgagatcctgcaattcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcatccgcgatgcaggcgaccgcacgcgag
atccacgagagcgaaacgctgatcaacgtcgaagaccgcgttgcatcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgtatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgcggcgatcgtgctcgcagcgagccgcggcaagggcctggaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgaacgccacgcacagacg
ggcgaactcgcgtcgctcgcctgcgcggccgaccgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtggtggtcgattcgtcgctcaccgaaaccaaccagagcgtgcgcgatttcgcg
ctctgctccgccgctgacgatcgcggcctgttcggccagaagacgtacctgcaacgcgta
tcgagcgacgtcgccgcaggcacgccgcacggccgctggatcggcctgctgaacgtgcgc
ggcgccggtgtcgagcgcctgaaggcgatgctcgcgacactacaggcgcgtccggatttc
gacacgctcgatatcccgtcgctgctcaacgaactgatcgccgccggcgagaagatcgaa
gtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgcgca
ggcgacttcgctcacggccagacgccgctgtccgaaccgggtgccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system