Bacillus cereus AH187: BCAH187_A2473 Help Entry BCAH187_A2473     CDS       T00799                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism bcr  Bacillus cereus AH187 Pathway bcr00261   Monobactam biosynthesis bcr01100   Metabolic pathways bcr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BCAH187_A2473  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcr01008]     BCAH187_A2473 Polyketide biosynthesis proteins [BR:bcr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BCAH187_A2473 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACJ80287 UniProt:  B7HR49 LinkDB All DBs Position 2313070..2313294 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLINEENQYSLWPVFLDVPIGWNVVHEEASRHDCLQYVENTWTDLNP KSNQAGEKIVVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaataaatgaggagaac cagtattctctctggcctgtctttcttgatgtacctattgggtggaatgtcgtacatgaa gaagctagcaggcacgattgcttacaatatgttgaaaatacctggacggatttgaatcca aaaagtaatcaagctggtgaaaaaatagtagtaggaaaacgataa

DBGET integrated database retrieval system