KEGG   Bacillus cereus E33L: BCE33L0226Help
Entry
BCE33L0226        CDS       T00198                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00473  D-Alanine metabolism
bcz01100  Metabolic pathways
bcz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCE33L0226 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BCE33L0226 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcz01011]
    BCE33L0226 (alr)
Enzymes [BR:bcz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BCE33L0226 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bcz01011]
 Precursor biosynthesis
  Racemase
   BCE33L0226 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAU20007
UniProt: Q63GX0
LinkDB All DBs
Position
242935..244104
Genome map
AA seq 389 aa AA seqDB search
MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSDVEIFAVVKGNAYGHDYVPVAKTALEAG
ATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDINVAAENDVALTVFQKEWVDEAIKLW
DGSSTMKYHINFDSGMGRIGIRERKELKGFLKSLEGAPFLELEGVYTHFATADEVETSYF
DKQYNTFLEQLSWLKEFGVNPKFVHTANSAATLRFQGITFNAVRIGIAMYGLSPSVEIRP
FLPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEWIATVAIGYADGWLRRLQGF
EVLVNGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQGDEYISATEVAEYSGTINYE
IITTISFRVPRIFIRNGKVVEVINYLNDI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcaccattttaccgtgacacttgggtggaagtggatttagatgccatttat
aacaacgttacacatattaaagaatttatcccgagtgatgtagaaatttttgccgttgtt
aaagggaatgcatatgggcacgattatgtaccggtggctaaaacagcattagaagcgggg
gcgacaaggttagcagttgcgttcttagatgaagctttagtgcttcgaagagctggtatt
actgcaccaattttggtgttaggtccttctcctcctcgtgatataaatgtagctgctgaa
aatgatgtagcattaactgtttttcaaaaggaatgggtagatgaagcaatcaaactttgg
gatggttcgtctacgatgaaataccatattaatttcgatagtggtatggggagaattgga
atacgtgaacgtaaagaattaaaaggatttttaaaaagcttagaaggtgcaccattctta
gaattggaaggagtttatacgcattttgcaacagcagatgaggtggagacttcttacttt
gataagcaatataacacatttttggagcagttaagttggttgaaagaattcggagtgaat
cctaagtttgttcatacagctaatagtgctgcaacgctacgttttcaagggattacattt
aatgcagtacgaattggcattgcgatgtatgggttatctccatctgtagaaatacgccct
tttttaccgtttaaattagaaccagcgctatcattgcatacgaaagttgctcatattaaa
caggtgattaaaggggatggaattagttataacgtcacttatcgaacgaaaactgaagaa
tggattgcgaccgttgcaattggttatgcagatggctggcttagaagattacaaggattt
gaagtacttgtaaatggtaaaagggtaccgattgtagggcgagtaacgatggatcaattc
atgattcaccttccttgtgaagtgcctcttggtacgaaagttacactcattggaaggcaa
ggagatgaatatattagcgctacagaggttgcggaatattcagggactattaattatgaa
attattacgacgatcagttttcgtgtgccgagaatatttatacggaatggaaaagttgtg
gaagtaattaattatttgaacgatatatag

DBGET integrated database retrieval system