KEGG   Bifidobacterium dentium Bd1: BDP_0423Help
Entry
BDP_0423          CDS       T01143                                 

Definition
(GenBank) Putative dehydrogenase
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NAD_binding_3 PglD_N ADH_zinc_N_2 Shikimate_DH 3HCDH_N DUF1188
Motif
Other DBs
NCBI-ProteinID: ADB09099
UniProt: D2Q8G3
LinkDB All DBs
Position
519915..520919
Genome map
AA seq 334 aa AA seqDB search
MKALVLTGVKEFEIQDLATPEILPNEVLINTAYAGVCGTDHDLYAGRPGSAAAVPPIVLG
HENSGVVAAIGAEVTNVKVGDRVAVDPNIYCGQCEYCLTQRPELCDHLSAVGVTRDGGLA
EQFTAPATVVYALPDNVSLRDAAAIEPVSCAVHGLDLLKLHPYQKALVIGDGFMGQIFAQ
LLQAYGVHRVDLAGIFDEKLERNKSQFGVTETYNTTREQIPSEAYDVIIEAVGLPATQAQ
AISAAKKGAQVLMFGVGPQEAHFEMNTYDIYKKQLTIQGSFINPLTFRDAISLVSSGKMN
IGGLISHELGLEEVQDFLDGKISGVSKAVVAIGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctggtacttaccggcgtcaaggaattcgagatccaagatctggccactccc
gagatactgccgaatgaggtgctgatcaacaccgcatatgcgggtgtgtgcggtaccgat
cacgatctgtatgcgggccgtcctggctccgccgcagccgtgccgccgatcgtgctgggg
catgagaactcgggcgtcgttgccgcgatcggtgctgaggtcaccaacgtcaaggtcggc
gatcgggtggccgtcgatccgaacatctactgcggtcaatgcgagtactgccttactcag
cgtccggaactgtgtgaccatctgagcgccgtcggcgtcacccgtgacggtggtctggcc
gagcagttcaccgctccggccaccgtggtctatgcgctgcccgacaatgtctccctgcgc
gacgccgccgccatcgagcccgtttcctgtgcggtgcatggccttgatttgctcaagctt
cacccgtaccagaaggctttggtcatcggtgacggcttcatggggcagattttcgctcag
ctgctgcaggcctacggtgtgcatcgggtcgacttggcgggcatcttcgacgagaagttg
gaacgcaacaagtcgcagttcggcgttaccgaaacctacaatacgacccgtgagcagatt
ccgtccgaggcctatgacgtcatcatcgaggccgttggacttccggcaacgcaggcgcag
gccatcagtgccgcgaaaaagggagcccaggtgctgatgttcggcgtcggcccgcaggaa
gcccatttcgaaatgaacacctatgacatctacaagaagcagttgaccatccaagggtcc
ttcattaacccgttgacgttccgtgacgccatctcgctggtgtcttcgggcaagatgaac
atcggcggactgatcagccatgagctcgggctcgaagaggtgcaggatttcctcgatggc
aagatttccggcgtttccaaggccgtcgtcgcaatcggcgactga

DBGET integrated database retrieval system