KEGG   Burkholderia dolosa: AK34_3284Help
Entry
AK34_3284         CDS       T03793                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00250  Alanine, aspartate and glutamate metabolism
bdl00410  beta-Alanine metabolism
bdl00640  Propanoate metabolism
bdl00650  Butanoate metabolism
bdl01100  Metabolic pathways
bdl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AK34_3284 (gabT)
   00650 Butanoate metabolism
    AK34_3284 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AK34_3284 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AK34_3284 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bdl01007]
    AK34_3284 (gabT)
Enzymes [BR:bdl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AK34_3284 (gabT)
Amino acid related enzymes [BR:bdl01007]
 Aminotransferase (transaminase)
  Class III
   AK34_3284 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJY09538
UniProt: A0A0D5ISS8
LinkDB All DBs
Position
2:complement(132991..134274)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAISDQLNSFTHTAYQIVPYASYVELAEKINARAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDTLKAKLTALQADVPQIADVRGPGAMIAVEFMK
PGTGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALGILDEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgcgaccccgcgcggtgtcggggtg
atgtgcgacttctacgcagcgcgcgcggagaacgccgagctgtgggacgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccatcgccacccgaag
atcgtgaaggcgatctcggaccagctgaacagcttcacgcacaccgcgtaccagatcgtt
ccgtacgcgtcgtacgtcgaactcgcggaaaagatcaacgcgcgcgcgcccggcgatttc
ccgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatc
gcgcgcgcggcgaccggccgtccgggcgtgatcgcgttctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttcggtccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcgctgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtgcagggcgaaggcggcttcaatccggcgccggccgagttc
gtgcgcgcgctgcgcaagatctgcaacgagcacggcatcctgctgatcgccgatgaagtg
cagaccggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtgctcgcc
gatctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtccggcgtcgtcggc
cgtgcggacgtgatggacgccgcggcgccgggcggcctcggcggcacgtatgcgggcaac
ccgctcgcggtcgcatcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gagcgcgcgacgcagctcggcgacacgctgaaggcgaagctgaccgcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggtcccggcgcgatgatcgcggtcgaattcatgaag
ccgggcaccggcgagccggacgccgagttcacgaagcgcgtgcaggcgcgcgcgctcgag
cgcgggctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgattccgcaagcggtcttcgacgaagcgctcggcatcctcgacgaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system