KEGG   Bdellovibrio sp. qaytius: CIK05_00190Help
Entry
CIK05_00190       CDS       T05880                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bdq  Bdellovibrio sp. qaytius
Brite
KEGG Orthology (KO) [BR:bdq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CIK05_00190 (ahpF)
Enzymes [BR:bdq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CIK05_00190 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored DAO FAD_binding_2 FAD_binding_3 Thi4 NAD_binding_8 Lycopene_cycl GMC_oxred_N AlaDh_PNT_C Glutaredoxin DSBA Thioredoxin_4 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AZZ35285
UniProt: A0A3T0RMJ5
LinkDB All DBs
Position
complement(37344..38912)
Genome map
AA seq 522 aa AA seqDB search
MLDADLKEQLKSVFANLENQIDLVYEQSKNANQNELVEMLTGVAETNPKISAKYDPASAA
HDGPPRFTVHKNGKSTGVFFTGIPGGHEFTSLILAILNADGKGKLPDAMILQRIKSLRGP
VRIRTFMSLDCENCPVVVQALNLMAIVHDDFHHETIDGAYAQEEIASLGVQGVPSVVVDG
KMIHSGRANFAELLKTLEETFGVDSSVAKLSGADANLGDYDVVVIGGGPAGASAAIYSAR
KGLKTAMIAERFGGQVQDTKGIENLISVVYTEGPQLAAQLNQHVLSYPVKMLEHRRVSRI
DKDENIIHLESGEFLKAHSTIITTGAKWRELNIPGEKEYLGRGVAFCPHCDGPFYKGKKI
AVIGGGNSGVEAAIDLAGIVSEVVLFEYNDSLKADAVLVDKLKSLPNAKIITSAKTTQVI
GNGTQVTALEYLDRNTNTVEKETLEGVFVQIGLLPNSQFAKDVVETNKFGEIVVDSKGRT
SAKNIYAAGDVTTTPFKQIVIAMGEGAKAALTAFEDRMYAGS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgctgatttaaaagaacaacttaaaagcgtattcgcaaatttagaaaatcaa
attgatttagtttacgaacaaagtaaaaacgcaaatcaaaatgaacttgtcgagatgtta
actggtgtggctgaaacaaacccaaaaatctctgctaaatatgacccagcatctgcggct
catgatggcccaccacgttttacagttcataaaaacggaaaatctaccggcgtgtttttt
actggtattcccggtggacacgaattcacttcattaattttagcgatcttaaacgcagac
ggaaaaggtaaacttcctgatgcgatgattttacaacgtattaaatctttacgtggccct
gttcgtattagaacttttatgtctttagattgtgaaaactgcccggtggtggttcaagct
ttaaatctaatggctattgttcatgatgattttcaccatgaaacgatcgacggcgcttac
gctcaagaagaaattgcaagtcttggtgtacaaggcgtacccagtgttgtcgttgacgga
aaaatgattcactcaggtcgcgcaaacttcgcagaattattaaaaacgttagaagaaact
tttggagttgattcatcggtggcaaaactttctggcgctgatgcaaaccttggtgattat
gatgttgttgttattggtggtggcccagcaggcgcctcagctgcgatttacagtgcgcgt
aagggtttaaaaacagctatgattgccgaacgtttcggtggtcaagtgcaagacactaaa
ggtatcgaaaatttaatttctgttgtttacactgaaggcccacaactagcggcgcaatta
aaccagcatgtattaagttatccggtaaaaatgttagaacaccgtcgtgtttcgcgcatt
gataaagacgaaaatattattcatttagaaagcggcgaatttttaaaagcgcattctaca
attattacgaccggcgctaaatggcgcgaattaaatattcctggtgaaaaagaatattta
ggccgtggcgtagccttttgccctcactgtgatggtcccttttataaaggtaaaaaaatt
gctgtgatcggtggtggtaattctggtgtagaagcagctatcgatttagcgggtattgtc
agcgaagttgttttatttgaatataacgactcattaaaagcagatgccgttttagttgat
aaactaaaatcactaccaaatgctaaaatcattacttctgccaaaacaacacaagtgatc
ggtaacggaactcaagtcactgcgttagaatacttagaccgcaacacgaatacagttgaa
aaagaaacactagaaggtgttttcgtacaaattggcttattacctaatagccagtttgca
aaagatgtagttgaaactaacaagttcggcgaaattgttgtagatagtaagggtcgcact
tcagcaaagaacatttatgcagctggtgacgtgaccacgacaccatttaaacaaatcgtg
atcgcgatgggcgaaggagcaaaagctgctctaacagccttcgaagatcgcatgtacgca
gggagctaa

DBGET integrated database retrieval system