KEGG   Bdellovibrio sp. ZAP7: DOM22_11885Help
Entry
DOM22_11885       CDS       T06441                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bdz  Bdellovibrio sp. ZAP7
Brite
KEGG Orthology (KO) [BR:bdz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DOM22_11885 (ahpF)
Enzymes [BR:bdz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DOM22_11885 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like Thioredoxin_3 FAD_oxidored DAO Thi4 Amino_oxidase FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Lycopene_cycl NAD_binding_9 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: QDK45798
UniProt: A0A514XJ86
LinkDB All DBs
Position
2421953..2423524
Genome map
AA seq 523 aa AA seqDB search
MLDQSLREQLVSVFGKLEKPVELIIDNSPHEDHKDLLEMLNDVAETSPNITIKESGNTSP
VPAFQIAYQGKPTGISFKGIPGGHEFTSLILAILNTDGKGKLLDSLLADRVKRLKKGITV
QTFMSLTCENCPEVVQALNLITLAHGNMKHEVIDGGYVQDEVQKLGIQGVPSLAGNGKMF
HSGRISVLDLIEKLEKTYGIDENASTEPSEPVNKNLGHFDVLVIGGGPAGASAAIYSVRK
GLSTALITEKIGGQVQETKGIENLIGVTYTEGPQLAAQLNQHVASYPVRVLENRRVKTIK
TEGKIKTVELESGEHLVADSIIVTTGAKWRELGVEGEKEYMGRGVAYCPHCDGPFYKGKK
VAVIGGGNSGVEAAIDLAGIVREVVVIEYNNELKADRILVDKLKSLPNVSVITGAKTERV
LGDGQKVHQLEYTDRTAGKLEKLDLDGVFVQIGLVPNSQFLKGTVELTKFGEIITDEKCR
TNVKGIYAAGDVTTTPYKQIVIAMGEGAKAALAAFEDRMYDHA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaatcactccgcgaacagctagtctctgtattcggcaaacttgaaaagccg
gtcgagctcatcatcgataacagcccccacgaagatcacaaagaccttcttgaaatgttg
aatgatgttgctgaaacatctccaaatattactattaaagagtctggcaacacttcgcca
gttccagctttccaaattgcttatcaaggcaaaccaacaggaatttcttttaaaggtatt
cctggcggtcacgaattcacttcgttgatccttgctatcctaaacactgatggcaaaggt
aaactactagatagtttacttgcagaccgcgtaaagcgtttgaaaaaaggcatcaccgtc
cagacgttcatgtctttgacttgtgaaaactgccctgaagttgttcaagctttgaacttg
atcacccttgctcatggcaacatgaagcatgaagtgatcgacggcggctatgttcaagat
gaagttcaaaaattgggtatccagggtgtgccaagcttggctggcaacggaaaaatgttt
cactcgggtcgcatcagcgttttggacttgattgaaaaactagaaaaaacatacggcatc
gacgagaacgcttcgacggagccttctgaacccgttaacaaaaacctgggtcactttgat
gtcctggttattggtggcggtcccgcaggagcgtcagccgcgatctattctgttcgtaaa
ggtttaagcacagctttgatcactgagaaaatcggtggccaagttcaagaaaccaaaggt
atcgaaaacttgattggtgtgacttacacagaaggtcctcaattggcagcgcaattgaat
caacacgtggcaagctatccagttcgcgttttggaaaaccgccgcgtgaaaacgatcaaa
actgaaggcaagatcaaaacggtcgagcttgaaagtggcgagcacttggttgcggattcc
atcatcgtcacaacgggtgcaaaatggcgtgagcttggcgttgaaggggaaaaagaatat
atgggccgtggtgtggcgtactgccctcactgtgatggcccattctataaaggtaaaaaa
gttgcggtaatcggcggaggaaattctggcgtggaagcagcaattgaccttgcgggtatc
gtgcgtgaagtggttgttattgaatacaataacgaacttaaggcggatcgcatcctggtt
gataaacttaaatcactgccaaacgtttctgtgatcacaggagcgaaaactgaaagagtt
ctaggtgatggccaaaaggttcatcaattggaatacacagatcgcacagctggcaaactt
gaaaagttagatcttgatggtgtattcgttcaaatcggcttagttcccaacagccaattc
ctaaaaggcactgtggaactgacgaagtttggtgaaatcatcaccgatgagaaatgccgc
acgaatgttaaaggtatttatgctgctggtgatgtgacaacaacgccatacaagcagatc
gtgatcgccatgggcgaaggcgcgaaagccgctttggcggctttcgaagatcgcatgtac
gatcacgcctaa

DBGET integrated database retrieval system