KEGG   Paraburkholderia fungorum: OI25_3260Help
Entry
OI25_3260         CDS       T03799                                 

Definition
(GenBank) penicillin-binding, 1A family protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00550  Peptidoglycan biosynthesis
bfn01100  Metabolic pathways
bfn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OI25_3260
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    OI25_3260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bfn01003]
    OI25_3260
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfn01011]
    OI25_3260
Enzymes [BR:bfn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     OI25_3260
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     OI25_3260
Glycosyltransferases [BR:bfn01003]
 Polysaccharide
  Bacterial polysaccharide
   OI25_3260
Peptidoglycan biosynthesis and degradation proteins [BR:bfn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   OI25_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AJZ59980
LinkDB All DBs
Position
1:3663653..3666154
Genome map
AA seq 833 aa AA seqDB search
MPIIKRPHSSNSPAGEDRDAYHRTPGRNAASRDAEAGRRSLGVTIVIGFFGLLATLAVVG
ALIVGYALVVMGPQLPSLDALTDYRPKVPLRVYTADHVLIGEFGEERRSIVRFQDIPDQM
KKAVLAIEDYRFYEHGGVDFVGILRAGVSDLMHGGASQGASTITMQVARNFFLSSEKTYT
RKIYEMMLAYKIERAMTKDQILEVYMNQIYLGERSYGFAAAARVYFGKDLKDVTLAEAAM
LAGLPKAPSAYNPVVNPKRAKIRQEYILKRMLELKYITQDQYDQAVKEEIHTRNPGNEYS
VHAEYIAEMVRQMMYAQYKDETYTRGLNVTTTIDSADQDAAYRAVRKGVMDYERRHGYRG
PEGFVQLPAPGDDRDQTIDDALTDHPDNGEIIAAVVTDANPKQVKAQLVDGTEVTISGDG
LRFAAGALSARATAATKIRPGSIVRLVADDKGNWQITQLPQVEGALVSLTPQDGAIRALV
GGFDFNKNKFNHVTQAWRQPGSSFKPFIYSAALDKGLGPATIINDAPLYFPPSTPGGDAW
EPKDDDQPDGPMPMRLALQKSKNLVSIRILSFIGTKYAQDFVTQRFGFDADKTPPYLPMA
LGAGLVTPLQSAGAYSVFANGGYRINPYLISEVTDARGEPLSKAQPLTAGRDAPRTLEPR
NAYIMNSLLHSVATAGTGAGTNVLHRSDLQGKTGTTNDAKDGWFAGYQQSLVAVAWMGYD
QPKSLGSREFGAQLALPIWVEYMQRALRGVPQSEPAQPDGVTSVDGELFYTDMTPGNGFV
ASIGLDSANPTAGASDAVGGVGPAGMTPPAVPVPSVSSNEKKQIMDLFETNKP
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcatcaaacgaccgcattcctcaaactctccggctggtgaagaccgggacgcc
taccaccgcactccaggacgcaacgctgcttcgcgcgacgctgaggccggtcgccggtcg
ctcggcgtaaccatcgtcatcgggtttttcggtctgctggcgacactcgccgtggtgggc
gcgctgatcgtcggttacgcgctcgtggtgatggggccgcaactgccgtcgctcgacgca
ctgaccgactatcggccgaaagtgccgctgcgggtgtacaccgcggaccacgtgctgatc
ggcgagttcggtgaggagcgccgcagcatcgtgcgcttccaggacattccggaccagatg
aaaaaggccgtgctcgcgatcgaagactatcgcttctacgagcacggcggcgtcgacttc
gtcggcatcttgcgcgcgggtgtctccgacctgatgcatggcggcgcctcccagggggca
agcacgatcacgatgcaggtggcgcgcaacttcttcctctcgagcgagaagacttacacg
cgcaagatttacgaaatgatgctcgcgtacaagatcgagcgcgcgatgaccaaggaccag
atccttgaggtctacatgaaccagatttatctgggcgagcgctcgtacggttttgccgcg
gccgcgcgcgtgtatttcggtaaggatctgaaagacgtcacgctggctgaggccgcgatg
ctggcgggcctgccgaaggcgccgtccgcgtataacccggtggtcaatccgaagcgcgcg
aagatccgtcaggaatacattctgaagcgcatgctcgaactgaaatacatcacccaggac
cagtacgaccaggccgtcaaggaagagattcatacgcgcaatccgggcaacgaatacagc
gtgcatgctgagtacatcgccgaaatggttcgccagatgatgtacgcgcagtacaaggac
gaaacctatacgcgcggcctgaacgtcaccaccacgatcgactccgccgaccaggacgcc
gcctatcgcgcggtgcgcaagggcgtgatggattacgagcggcgtcacggctaccgtggg
ccggaaggcttcgtgcaattgcccgcgccgggcgacgaccgcgatcagacgatcgacgat
gcgctcaccgatcaccccgacaacggcgaaatcatcgccgccgtggtgacggacgcgaat
ccgaagcaggtgaaggcgcaactggtcgacggcaccgaagtgacgatcagcggcgacggc
ctgcgcttcgcagccggcgcgctttccgcacgcgcaacggccgccacgaagatcaggccg
ggctcgattgtgcgcctcgtcgccgacgacaagggcaactggcaaatcacgcagcttccg
caagtggaaggcgcactggtctcgctcacgccgcaggacggcgcgattcgcgcgctggtg
ggcggcttcgacttcaacaagaacaagttcaaccacgtgacgcaggcgtggcgccaaccc
ggttcgagcttcaagccgttcatctactcggcggcgctcgacaaggggctcggaccggcc
acgatcatcaacgacgcgccgctgtacttcccgcccagcacgccgggtggcgacgcgtgg
gagccgaaggacgacgatcagccagacggtccgatgccgatgcggctcgcgctgcagaag
tcgaagaacctggtgtcgatccgcatcctgtcgttcatcggcaccaagtacgcgcaagat
tttgtcacgcagcggtttggtttcgatgccgacaagactccgccgtatctgccgatggcg
ctcggcgcgggcctcgtcacgccgctgcaatcggcgggcgcctactcggtgttcgcgaac
ggtggctaccgcatcaatccgtatctgatcagcgaggtaacggatgcgcgcggcgagccg
ctctcgaaagcgcaaccgctgaccgccggccgcgatgcgccgcgcacgcttgaaccgcgt
aacgcgtacatcatgaacagcctgctgcattcggtggccacggccggcacgggtgcgggc
accaacgtgctgcatcgttcggacttgcagggcaagaccggtacgaccaacgacgcgaag
gacggctggttcgccggttatcagcagtcgctggtggcggtggcgtggatgggttacgac
cagccgaagagcctcggcagccgcgagtttggcgcgcagctcgcgttgccgatctgggtc
gagtacatgcagcgcgcgttgcgtggcgtgccgcaaagtgagccggcgcagccggacggc
gtgacctccgtcgacggcgagctgttctatacggacatgacgccgggtaacgggttcgtg
gccagcatcggcctcgattcggcgaatccgaccgccggcgcgagcgacgcggtgggcggc
gtggggccggctggcatgacaccaccggcggtgccggtgccgagcgtctcgtcgaatgaa
aagaaacagatcatggatctgttcgagacgaacaagccttga

DBGET integrated database retrieval system