KEGG   Branchiostoma floridae (Florida lancelet): 118412018
Entry
118412018         CDS       T01074                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB
Motif
Pfam: EphA2_TM LST1 Hum_adeno_E3A Glycophorin_A DUF4381 TMEM154 RIFIN DUF2244 7TM_GPCR_Srw Rhabdo_glycop BatA Shisa SRTM1 Herpes_gE HemY_N Cadherin_C_2 MLANA DUF2207 Stevor RCR PTP_tm Mid2
Other DBs
NCBI-GeneID: 118412018
NCBI-ProteinID: XP_035670495
LinkDB
Position
3
AA seq 154 aa
MRTTSDQILLLALCLMPGTASRAERDADGDECPDRFTGYCLRGICEYIAEADEALCLCPT
DYWGPRCNHALVEQQVANDLVDVPVAVIVGAIFVSLLVLLLVILLIICIRRYRRRRQARQ
RPHILLNGTHSVGVRSQISEKVNPPLLVEYMTTV
NT seq 465 nt   +upstreamnt  +downstreamnt
atgcggaccacatcggaccaaatcttgcttcttgcgctctgtctcatgccaggaacagcg
tcacgggcagaacgtgatgctgatggtgacgagtgcccggacaggtttaccggctactgt
ctgcgggggatctgtgagtacatagcggaggcagacgaagcattgtgtttatgtccaaca
gactactgggggcctcggtgtaaccatgcacttgtggagcaacaagttgccaatgacttg
gtggatgtaccggtggctgtaattgtcggtgccatcttcgtatccctgttggtcctattg
ctagtcatcttgcttatcatctgtatacgaagatacagaagacggagacaggcgaggcaa
agaccacacatactgctaaatggcacacattcagttggggtgaggagccagatatcagaa
aaggtcaacccacctttgctggtggaatacatgacaactgtatag

DBGET integrated database retrieval system