KEGG   Blastomonas fulva: B5J99_05290Help
Entry
B5J99_05290       CDS       T05612                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bfw  Blastomonas fulva
Pathway
bfw03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    B5J99_05290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bfw03400]
    B5J99_05290
Enzymes [BR:bfw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B5J99_05290
DNA repair and recombination proteins [BR:bfw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     B5J99_05290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ASR50959
UniProt: A0A222WWK2
LinkDB All DBs
Position
complement(1124987..1127464)
Genome map
AA seq 825 aa AA seqDB search
MARAADLLADYNAKRDFKQTPEPAGKVSKAAGNRFIVQKHDATRLHFDLRLEIDGVLKSW
AVTKGPSANPEDKRLAVRTEDHPMSYADFEGVIPKGAYGGGTVMLWDSGSWAPIAGKSAH
DIEEGHLHFTLDGQRMKGEWLLVRMKPRPGEKRENWLLRKIADRWAGGTDDLVGRALTSV
LSDRTMAQIAAGEEGLKPDLGAKPASTAKPASKRRSKGTPPKFRALQLATLVDAVPAGHD
WIHEIKYDGYRAAVAAAGSDVRIYTRNGLDWTDKFAPLVAHIAALDLPPCLIDGEIVAFD
ANGNPDFSALQAVLKRGKGAQDAKTELQFFAFDLIEQDGKSLTTLGNLERKERLEALLHD
AAPPIAVADHVIGAGERLYAAMCSAGQEGIISKRAESGYAGKRSTNWVKVKCTRRQEFVI
VGWNPSRAKGRPFASLLLAQHEGDALVYKGNVGTGFSADGMDDLARTFAKLARKTAPLPV
EGAAARHAHWLKPELVAEIAFAEFTAGGAVRHASFLGLRGDKAARDVTPEVARPAPADHD
VVTITSRDRVIFPEAKKTKGDLADYYAAVAPVMVMHAARRPISLVRCPQGRAKACFFQKH
DSGSFGEHVHHISIREKDGGHEDYLYVEDAAGLLACVQMGTIEFHGWGSQIAAVEHPDRM
VFDLDPDEGLDFADVRKAALDIRGHLADMGLVSFAMLTGGKGVHVVVPLDPGHSWDAHKA
FARHFAEALSMAEPDRFVATMSKAKRKGRIFIDWLRNQRGSTAVMPYSARARPHAPVAVP
IGWEALAEAKSASRYTIDDSSLLLERAARSDLQGWGFAAQALPQY
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggcaagggccgccgatctgcttgccgactataacgccaagcgcgatttcaagcagacg
cctgagcccgccggaaaggtgtcgaaggctgcaggcaaccgcttcatcgtgcagaagcac
gatgccacgcggctgcacttcgatctgcggctcgagatcgacggcgtgctcaagagctgg
gcggtcaccaaggggcccagcgccaatcccgaagacaaaaggctggcggtgcgcaccgag
gaccatccgatgtcgtacgccgatttcgagggcgttatccccaagggtgcctatggcggc
ggcacggtgatgctgtgggacagcggcagctgggcaccgatcgccggaaaaagcgcgcac
gacatcgaggaggggcatctccacttcacgctcgacggccagcggatgaagggcgaatgg
ctgctggtgcggatgaagccgcgccccggcgaaaagcgcgagaactggctgctgcgcaag
atcgccgacagatgggccggtggcacggatgatctggttggccgcgcgctcaccagcgtt
ctcagcgaccggacgatggcacagatcgctgcgggggaagaaggcctgaaaccagacttg
ggcgcaaagcctgccagcacggccaaacccgcatccaaacgccggtccaagggcacgccg
cccaagttccgtgccctgcagctggcgacattggtcgatgccgtccctgccgggcacgac
tggatccacgagatcaagtatgacggctatcgcgccgccgtcgccgcagcgggcagcgac
gtgcgcatctacacgcgcaacggactggactggaccgacaagtttgcgccgctggtcgcc
cacatcgccgcgctcgatcttccgccctgcctgatcgatggcgagatcgtcgcgttcgac
gccaacggcaaccccgatttctctgcgctgcaggccgttctcaaacgcggcaagggcgcg
caggacgcaaagaccgaattgcagttcttcgccttcgacctgatcgagcaggacggcaag
tcgctgaccacgctgggcaatctcgagcgcaaggaacggctcgaagcgctgctgcatgat
gccgccccgccgatcgcggtggccgatcatgtcatcggtgccggggagaggctgtacgcc
gcgatgtgcagcgcggggcaggaggggatcatctccaagcgcgccgaatcgggctatgcc
ggcaaaaggtcgaccaactgggtcaaggtgaagtgcacccgccgccaagagttcgtcatc
gtcggctggaacccctccagggcgaaggggcggccgttcgcctcgctgctgctcgcccag
cacgagggcgatgcattggtctacaagggcaatgtcggcacggggttcagcgccgatggc
atggacgatcttgcgcggactttcgcgaaactcgcccgcaagaccgcgccgttgcccgtc
gagggtgccgccgcccgccatgcgcactggctgaagcccgagcttgtcgccgagatcgca
tttgcggaattcaccgcgggcggagcggtccggcatgcgagctttctgggcctgcgcggc
gacaaggcagcgcgcgatgtgaccccggaggtcgcacggcccgcgccagccgaccatgat
gtggtcacgatcaccagccgcgatcgcgtcatcttccccgaagcgaagaagaccaagggc
gaccttgcggattattatgccgcggtcgctccggtcatggtgatgcatgctgcgcgccgc
ccgatcagcctggtgcgctgtccgcaggggcgcgccaaggcgtgcttcttccagaagcat
gattcgggctcgttcggcgagcatgtccaccatatcagcattcgcgagaaggacggcggg
cacgaagactatctgtatgtcgaggatgccgccgggctgctggcctgtgtgcagatgggg
acgatcgagttccacggctggggcagccagattgcggcggtcgagcatcccgaccggatg
gtgttcgatctcgatcccgacgagggtctcgattttgccgatgtcagaaaggccgcgctc
gatattcgcgggcatcttgccgacatgggcctggtcagctttgcgatgctcaccggcggc
aagggcgtgcatgtcgtggtgccgctcgatcccgggcacagctgggatgcgcacaaggcc
tttgcgcgccactttgccgaagcgctgagcatggccgagcccgaccgctttgttgcaacc
atgagcaaggccaagcgcaagggcaggatcttcatcgactggctgcgcaaccagcggggc
agcacagccgtgatgccctattcggcccgcgcccgcccgcatgcgccggtggcggtgccg
atcggctgggaagcgctggcagaagcgaagagcgcaagccggtacacgatcgacgacagc
agcctgctgctcgagcgggcggcaaggtccgaccttcagggctggggatttgcagcgcag
gccctgccccaatactga

DBGET integrated database retrieval system