KEGG   Burkholderia gladioli BSR3: bgla_1g36110
Entry
bgla_1g36110      CDS       T01464                                 

Definition
(GenBank) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    bgla_1g36110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgd01007]
    bgla_1g36110
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bgd03016]
    bgla_1g36110
   03029 Mitochondrial biogenesis [BR:bgd03029]
    bgla_1g36110
Enzymes [BR:bgd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     bgla_1g36110
Amino acid related enzymes [BR:bgd01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   bgla_1g36110
Transfer RNA biogenesis [BR:bgd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    bgla_1g36110
 Prokaryotic type
   Other AARSs
    bgla_1g36110
Mitochondrial biogenesis [BR:bgd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    bgla_1g36110
SSDB
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1 tRNA-synt_1g tRNA-synt_1e
Other DBs
NCBI-ProteinID: AEA62214
UniProt: F2LF15
LinkDB
Position
1:4099806..4101590
AA seq 594 aa
MLPAQKHILETLLADSVKQVVQALKGESEAGFVAPTITLERPKAAAHGDVACNVAMQLAK
PLGTNPRQLAEKIVAAVTAHPSAAGLVEAAEIAGPGFINLRLTAAAKQAVIGAVFAEREA
FGRSAHEAGRRVLLEFVSANPTGPLHVGHGRQAALGDVLANVLASQGYAVHREFYYNDAG
VQIGNLALSTQARARGLKPGDADWPEAAYNGEYIADIARDYLAGATVSASDGEPVTGKGD
IEDIEAIRKFAVAYLRREQDIDLKAFGVRFDQYYLESSLYQEGRVESTVQALVDAGMTYE
QEGALWLRTTDEGDDKDRVMRKTDGTYTYFVPDVAYHVAKWQRGFTKVINIQGSDHHGTI
ARVRAGLQGLHIGIPKGYPDYVLHKMVTVMRDGQEVKLSKRAGSYVTVRDLIEWSGGATP
DAEVSPEQLDEAIITRGRDAVRFFLISRKADTEFVFDIDLALKQNDENPVYYVQYAHARI
CSVLNEWKSRHGADEAILPGADLSPLDSKPAASLLQKLAEYPEMLTHAAGELAPHAVAFY
LRDLAGEFHSFYNAERVLVDDEAQRTARIALLAATRQVLANGLAVLGVSSPSKM
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgctgcccgctcaaaaacacatactcgaaaccctgctcgccgacagcgtgaagcaggtc
gtccaggccctgaagggcgaatccgaggccggtttcgtcgcgccgacgatcaccctggag
cgccccaaggcggccgcccacggcgacgtcgcctgcaacgtcgcgatgcagctggccaag
ccgctcggcaccaacccgcgccagctggccgagaagatcgtggcggccgtgacggcccat
ccgtcggcggcggggctggtcgaggccgccgagatcgccggccccggcttcatcaacctg
cgcctgaccgcggccgccaagcaggccgtgatcggcgcggtgttcgccgagcgcgaggcc
ttcggccgctccgcccacgaggccgggcgccgcgtgctgctcgaattcgtctcggccaac
ccgaccggcccgctgcacgtcggccacggccgccaggccgcgctcggcgacgtgctggcc
aacgtgctggccagccagggctacgcggtgcaccgcgagttctactacaacgacgccggc
gtgcagatcggcaacctggcgctgtcgacccaggcgcgcgcgcgcggcctcaagcccggc
gacgccgactggcccgaggccgcctacaacggcgagtacatcgccgacatcgcgcgcgac
tacctggccggcgccacggtctcggccagcgacggcgagcccgtcaccggcaagggcgac
atcgaggacatcgaggcgatccgcaagttcgcggtcgcctacctgcgccgcgagcaggac
atcgacctgaaggccttcggcgtgcgtttcgaccagtactacctggaatcctcgctttac
caggaaggccgcgtcgagagcacggtgcaggccctggtcgacgccggcatgacctacgag
caggaaggcgcgctgtggctgcgcaccaccgacgagggcgacgacaaggaccgcgtgatg
cgcaagaccgacggcacctacacctacttcgtgcccgacgtcgcctaccacgtggccaag
tggcagcgcggcttcaccaaggtcatcaacatccagggctcggaccaccacggcaccatc
gcgcgcgtgcgcgccggcctgcagggcctgcacatcggcatcccgaagggctatcccgac
tacgtgctgcacaagatggtgacggtgatgcgcgacggccaggaggtgaagctctccaag
cgcgccggcagctacgtgacggtgcgcgacctgatcgaatggtcgggcggcgccacgccg
gacgcggaagtctcgcccgagcagctcgacgaggccatcatcacgcgcgggcgcgacgcg
gtgcgtttcttcctgatttcacgcaaggccgacacggaattcgtgttcgatatcgatctc
gcgctgaagcagaacgacgagaatccggtctactacgtgcagtacgcgcatgcgcggatc
tgctcggtgctcaacgagtggaagtcgcgccacggcgccgacgaggcgatcctgccgggc
gcggacctctccccgctcgacagcaagccggccgcctcgctgctgcagaagctcgccgag
taccccgagatgctcacgcacgcggccggcgaactcgcgccgcacgcggtggccttctac
ctgcgcgacctcgcgggcgagtttcactcgttctacaatgcggagcgcgtgctcgtcgac
gacgaggcgcaacgcaccgcgcgcatcgcgctgctggccgcgacgcgccaggtgctcgcg
aacggtctcgcggtgctcggcgtgtcctcgccgagcaagatgtaa

DBGET integrated database retrieval system