Paraburkholderia atlantica CCGE1002: BC1002_0262 Help Entry BC1002_0262       CDS       T01217                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism bge  Paraburkholderia atlantica CCGE1002 Brite KEGG Orthology (KO) [BR:bge00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bge03110]     BC1002_0262 Chaperones and folding catalysts [BR:bge03110]  Protein folding catalysts   Protein disulfide isomerase    BC1002_0262 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 SH3BGR Motif Other DBs NCBI-ProteinID:  ADG14369 UniProt:  D5WAR6 LinkDB All DBs Position 1:289783..290043 Genome browser AA seq 86 aa AA seqDB search MNKVIMYSTQVCPYCQMAERLLKSRGVEHVEKVLIDKDPARREEMMTRTGRRTVPQVFIG ETHVGGYDDLSALDRAGGLTPLLEAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaagtgatcatgtacagcacccaggtgtgcccgtattgccagatggccgaacgt cttttaaagtcgcgcggcgtcgagcacgttgagaaagtactgatcgataaagacccggcc cgtcgtgaggagatgatgacccggaccggtcgtcgcacggtgccgcaggtgttcatcggc gagacgcatgtcggcggctatgatgacctttccgcgctcgatcgcgcgggcggtctgacg ccgctgctcgaagcagcctga

DBGET integrated database retrieval system