KEGG   Burkholderia sp. CCGE1002: BC1002_5544Help
Entry
BC1002_5544       CDS       T01217                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00061  Fatty acid biosynthesis
bge00780  Biotin metabolism
bge01100  Metabolic pathways
bge01130  Biosynthesis of antibiotics
bge01212  Fatty acid metabolism
Module
bge_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BC1002_5544
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BC1002_5544
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BC1002_5544
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bge01004]
    BC1002_5544
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BC1002_5544
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BC1002_5544
Lipid biosynthesis proteins [BR:bge01004]
 Fatty acid synthase
  Component type
   BC1002_5544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ADG19469
UniProt: D5WGL8
LinkDB All DBs
Position
2:2575354..2576136
Genome map
AA seq 260 aa AA seqDB search
MSVEQPRLILEGAKALVTGVANEHSIAYGCAKAFRDLGASVALTYANDKAAPYVEPIAKA
LDAEIFMPLDVTGEDEMEAVFDRIEKTWGELDILVHAVAWAPKADLQGGLLQSSREGFLS
AIDISCHSFVRMARLAAPLMKDGGTMLTMSYYGANKVVPNYNLMGPVKAALEACARYLAF
ELGPKGIRVHAISPGPLQTRAASGLKDFELLLNEAVQRAPLGELVDIMDVGYTCAFLATP
YARRVSGSTLYIDGGLNIVA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgagcaaccgcgtttgattctggaaggagcgaaggcgctcgtgaccggcgtc
gccaacgagcattcgattgcgtacggatgcgcgaaggcgtttcgcgacctcggcgcgagc
gtcgcgctcacctatgcgaacgacaaggcggcgccttatgtggaaccgatcgccaaagca
ctcgatgccgagatcttcatgccgctcgacgtaacgggcgaggacgaaatggaggccgtg
ttcgaccggatcgagaaaacatggggggagctcgacattctcgttcacgccgttgcatgg
gcgcctaaagcggatctgcagggcggcttgctgcaatcgtcgcgtgagggcttcctgagc
gcgatcgatatctcctgccattcgttcgtgcgcatggcgcgcctcgccgcgccgctgatg
aaagacggcggcaccatgctgacgatgagctactacggcgcgaacaaggtcgtgccgaac
tacaacctgatggggccggtcaaggcggcgctcgaagcctgcgcgcgctatctggcgttc
gagctgggaccgaagggcatccgcgtgcatgcgatttctcccggaccgctgcagactcgc
gctgcttcgggcctgaaggatttcgaactgctgctcaacgaagcggtgcagcgcgcgccg
ctcggcgaactggtcgacatcatggacgtcggctatacctgtgcgtttctggccacgccg
tatgcgcggcgggtgtccggttccaccttgtatatcgacggcggattgaacatcgttgct
tag

DBGET integrated database retrieval system