KEGG   Brachybacterium ginsengisoli: CFK41_15650Help
Entry
CFK41_15650       CDS       T05099                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-ProteinID: ATG56054
UniProt: A0A291H116
LinkDB All DBs
Position
complement(3481543..3482889)
Genome map
AA seq 448 aa AA seqDB search
MADVIVGRFALIDLIAKGGSGSVWRAWDSKTEKLCAAKVLRQRDSADLMRFVREKGVSFD
HPHLLTPYGWGAEDEHVVIAMPLVSGGTLESVVKKKGRLAEPAVVVILDQLLDGLSHIHA
EGWIHRDVKPANIMFEARGNAFPASRLADFGIAVHETDVRFTHVGMVNGTPGYMAPELFS
MAEPAPSHDLYAAGVVAMVALNGPIKLHDGSFRPEELNQHLQGVTPKLSAVIRRLVAAQP
EDRYQDADSVRRDLPRVPRGYPLTHADGTPLQFVDTLEPMPANAPGASRPQRPAATSSGP
SMEAIRSGRVQQGFSSPSASPQTGPQWAQQTPPQAAGAPQPQGAGSPPSAPFTPHPYTRT
QTTTGSTGQNQSSRRSTMIAIVLGSASALVLGALVAIILLAVFNNPSAAAPLDEGGGAVS
GVVASSGEVDGGSGLVPGASDGEGPATS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgttattgtcgggcgcttcgcgctcatcgacctgatcgccaagggcggttcc
gggtccgtctggcgcgcctgggactcgaagacggagaagctctgcgcggcgaaggtgctg
cgccagcgggactcggccgatctcatgcgcttcgtgcgcgagaagggcgtcagcttcgat
catccgcatctgctcaccccgtacggctggggagccgaggacgagcacgtggtgatcgcg
atgccgctggtctccggcggcaccctcgaatccgtggtgaagaagaagggccggctcgcc
gagccggccgtggtggtcatcctcgaccagctgctcgacggcctctcccacatccacgcc
gagggctggatccaccgcgacgtgaagcccgcgaacatcatgttcgaggcgcgagggaac
gccttccccgcctcgaggctggccgacttcgggatcgcggttcacgagaccgatgtgcgc
ttcacgcacgtcggcatggtcaacggcaccccggggtacatggcgcccgagctgttctcg
atggccgagcctgccccctcccacgacctgtacgccgccggggtggtggcgatggtcgcg
ctgaacggtccgatcaagctgcacgacggctcgttccggcccgaggagctgaaccagcac
ctgcagggcgtcaccccgaagctctccgcggtgatccgtcgcctggtcgcggcgcagccc
gaggaccgctaccaggacgccgactcggtgcgccgggacctgccgcgcgtgccgcggggc
tacccgctcacccacgccgacggcacgccgctgcagttcgtggacacgctcgagccgatg
cccgcgaacgcccccggcgcgtcccgcccgcagcgtccggcggcgacatcctccggcccg
tcgatggaggcgatccggtccggacgggtccagcagggcttcagctccccctcggcctcg
ccgcagaccggcccgcaatgggcgcagcagacaccgccccaggccgcgggggcgccgcag
ccccagggcgccgggtcgccgccgagcgccccgttcaccccgcatccgtacacgcgcacc
cagaccacgaccggcagcaccgggcagaaccagtcgtcccggcgcagcacgatgatcgcg
atcgtgctgggatccgcctcggcgctcgtgctgggcgccctggtggccatcatcctgctg
gcggtcttcaacaatccctcggccgccgcgccgctcgacgagggcggcggtgccgtcagc
ggtgtcgtcgcgtcctccggcgaggtcgacggcggttccggtctggtgccgggggcatcc
gacggagagggccccgcgacctcctga

DBGET integrated database retrieval system