KEGG   Bacillus gibsonii: BGM20_07410
Entry
BGM20_07410       CDS       T04820                                 

Definition
(GenBank) PTS mannose transporter subunit IID
  KO
K02771  fructose PTS system EIID component
Organism
bgi  Bacillus gibsonii
Pathway
bgi00051  Fructose and mannose metabolism
bgi02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BGM20_07410
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BGM20_07410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgi02000]
    BGM20_07410
Transporters [BR:bgi02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BGM20_07410
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AOL30466
LinkDB
Position
complement(1417129..1417956)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagaaagaaaaacgattaacgaagaaagaaattttcagcatgtttattcgttcaaat
tttttactcggttcctttaacttcgaacgtgtgcaggcaatgggatattgttatgtcatg
ataccggcgatcaaaaaattgtacggtcccggagcgaaaagaaacgaagccttgcagcgg
catttggaatggtttaatacacatccgtggctgacagcgcctatatttggtgtgacggca
gccatggaagaagaaatggcgaacaataaaggaattgacggaaaagcgataagcggaatg
aaaattggtttgatgggaccaatagcgggcgtaggcgacccaattttctggggaacgatt
cgtcctgtcttagctgcgctaggagcctcccttgctttaggaggaaacattgccggccct
ttgctattctttttcttgctgaatgccataagattaagcacaaaatattacggattaaag
tatggctatgtgaaaggaatggagattcttcaggatttagcggggaatcgcattcaaaag
cttacagagggcgcttcgattctcgggttatttgttatgggggctctcgtgtccaaatgg
accaccatcaacattccaatcgttgtatccaggattaaggatgaaagcggaaaagtagat
gttcaaactgtacaaaacgtgttagacagcattatgccgggtgcgctgcctctcggatta
acgttattggtggcatggatgcttcgcaaaggggtgaatccacttctcattatttgcggc
atctttgtcatcgggattctcgggtattgggctggattcttagcataa

DBGET integrated database retrieval system