KEGG   Burkholderia glumae BGR1: bglu_2g16350Help
Entry
bglu_2g16350      CDS       T00905                                 

Definition
(GenBank) Putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    bglu_2g16350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgl02000]
    bglu_2g16350
Enzymes [BR:bgl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     bglu_2g16350
Transporters [BR:bgl02000]
 Other Transporters
  Pores ion channels [TC:1]
   bglu_2g16350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ACR31975
UniProt: C5AJ95
LinkDB All DBs
Position
2:2057839..2058513
Genome map
AA seq 224 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGIPYELKRYERDPKTLRAPPALRDVHPLGKSPVLTDDG
ETVAESGAIIEYLLERYDTDSRFAPAPGTPERRRFTYWLHYAEGSAMPPLLLKLVTMRIA
QAPMPFFVKPIARKFAATLQSSFVDPQLKLHLGYIEESLRATGWFAGDAFSAADVQMSFP
LEAAASRADAVAQLPAIRAFLERIHARPAYHRALARGGPYDMVR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccatcacctcaacaattcccgctcgcagcgcgtgctgtggctgctcgaa
gagctcggcatcccctacgagctgaagcgctacgagcgcgatccgaagacgttgcgcgcg
ccgcccgcgctgcgcgacgtgcacccgctcggcaagtcgccggtactgaccgacgacggc
gaaaccgtcgccgagtcgggcgcgatcatcgaatacctgctcgaacgctacgacacggac
tcgcgcttcgcccccgcgcccggtactccggagcggcggcgcttcacctactggctgcac
tacgcggagggctcggcgatgccgccgctgctgctcaagctggtgaccatgcgcatcgcc
caggcgccgatgccgttcttcgtcaagccgatcgcacgcaagttcgccgcgacgctgcag
tcgagcttcgtcgatccgcagctgaagctgcatctcggctatatcgaggagtcgctacgc
gccacgggctggttcgccggcgacgcgttcagcgccgccgacgtgcagatgagctttccg
ctggaggcggccgcctcgcgcgccgatgccgtcgcgcagctgccggcgatccgcgcgttc
ctcgaacggatccatgcgcggcccgcctaccaccgtgcgctggcgcgcggcggtccctac
gacatggtgcgctga

DBGET integrated database retrieval system