KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_5582Help
Entry
KS03_5582         CDS       T03820                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00250  Alanine, aspartate and glutamate metabolism
bgu00410  beta-Alanine metabolism
bgu00640  Propanoate metabolism
bgu00650  Butanoate metabolism
bgu01100  Metabolic pathways
bgu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KS03_5582 (gabT)
   00650 Butanoate metabolism
    KS03_5582 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KS03_5582 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KS03_5582 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgu01007]
    KS03_5582 (gabT)
Enzymes [BR:bgu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KS03_5582 (gabT)
Amino acid related enzymes [BR:bgu01007]
 Aminotransferase (transaminase)
  Class III
   KS03_5582 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJY63200
LinkDB All DBs
Position
II:2792651..2793934
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVMNTGHRHPK
LVKAIAAQLEQFTHTAYQIVPYASYVELAEKIIARAPGSFAKKAAFFTTGAEAVENAVKM
ARAFTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNPLHGVSVA
ASLKAIDLLFKADIDPKRVAAIIFEPVQGEGGFYAAPADFVRGLRKICDEHGIVLIADEV
QTGFARTGKLFAMQHHDVLPDLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDIIDEERLEARAVTLGDKLKARLAALQPEVPQIADVRGPGAMVAVEFFK
AGTQEPDADFTKRVQARALERGLLLLICGVHSNVIRFLFPLTIPDAVFDEALGILDTVLK
ETVGVAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgatctgcaagcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgacttctatgccgcgcgcgccgagaacgccgagctgtgggacgtggagggccgc
cgcttcatcgatttcgcggccggcatcgcggtgatgaacaccggccaccgccacccgaag
ctcgtcaaggcgatcgccgcgcagctcgagcaattcacgcacacggcctaccagatcgtt
ccctacgcgtcctacgtcgaactggccgagaagatcatcgcgcgcgcgccgggcagcttc
gcgaagaaggccgcgttcttcaccacgggcgccgaggccgtcgagaacgccgtcaagatg
gcgcgcgccttcaccggccgccccggcgtgatcgcgttcgcgggcggcttccacggccgc
accatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctcaatttcgggccg
ttcccgggcgacgtgttccacgcgccctacccgaacccgctgcacggcgtgagcgtggcc
gcctcgctgaaggcgatcgacctgctgttcaaggccgacatcgatccgaagcgcgtggcg
gcgatcatcttcgagccggtgcagggcgaaggcggcttctacgcggcaccggccgatttc
gtgcgcggcctgcgcaagatctgcgacgagcacggcatcgtgctgatcgccgacgaggtg
cagaccggcttcgcgcgcaccggcaagctgttcgcgatgcagcaccacgacgtgctgccc
gacctcatcaccatggccaagagcctcgcgggcggcatgccgctgtcgggcgtggtcggc
cgcgccgacgtgatggacgcggccgcgccgggcggcctcggcggcacctacgcgggcaat
ccgctcgcggtggccgccgcgcacgcggtgctcgacatcatcgacgaggaacggctcgaa
gcgcgcgccgtcacgctcggcgacaagctcaaggcgcggctcgccgcgctgcagcccgag
gtgccgcagatcgccgacgtgcgcggcccgggcgccatggtggccgtcgagttcttcaag
gccggcacgcaggagccggacgcggacttcaccaagcgcgtgcaggcgcgcgcgctcgaa
cgcggcctgctgctgctgatctgcggcgtccactcgaacgtgatccgcttcctgttcccg
ctgacgatcccggacgccgtgttcgacgaagcgctcggcatcctcgacaccgtgctgaag
gaaaccgtcggcgtcgccgcctga

DBGET integrated database retrieval system