KEGG   Bartonella henselae Houston-1: BH00610
Entry
BH00610           CDS       T00180                                 

Gene name
batS
Definition
(GenBank) Two-component sensor histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
bhe  Bartonella henselae Houston-1
Pathway
bhe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bhe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BH00610 (batS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bhe01001]
    BH00610 (batS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bhe02022]
    BH00610 (batS)
Enzymes [BR:bhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BH00610 (batS)
Protein kinases [BR:bhe01001]
 Histidine kinases
  OmpR family
   BH00610 (batS)
Two-component system [BR:bhe02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   BH00610 (batS)
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_3 HATPase_c_2 DUF2730
Other DBs
NCBI-ProteinID: CAF26877
UniProt: A0A0H3LVQ2
LinkDB
Position
complement(82841..84625)
AA seq 594 aa
MTKNTQLETLQKITPNGLPSSPFSILSDLRFRTQRLLRQLLFSSLTRRIVILNLAALAIL
VTGILYLNQFRDGLIEAKIKSLCIQGKIIAGAIAASATVDTNSILIDPQKLLELQAGESV
TPAPQSTDSWDFPINPEQVAPLLRRLITPKTTRARIYDRDATLLLDSRVLYSSGEVFSYD
LPPLKTEKKLWERLYSWFSNALYGNGLAIDREQAKKRGIVHPEVYRALNGSLATAKRRNR
QGQLIVSVAVPVQRYRAVVGALLLSTTGSDIDDIVKGERLVIFKVFAVVGSVLLVLSLFL
AHTIAHPLSKLSASANRVRNGNNKRVEIPDFSMREDEIGHLSTSIRDMTNALYMRIEAIE
RFAADVSHELKNPLTSLRSAVETLPLAKNEEAQEQLIEIIQHDVRRLDRLITDISDASRL
DAELARETAQIVDVTLLLESLVHAVQEVYRNRQNIDISLNIIPRPHGKPYLVLGHELRLG
QVISNLIENARSFIPHDNGKICITMKSNAANLVLIIEDNGPGIRSENIERIFERFYTDRP
SEDTFGQNSGLGLSISRQIIEAHNGTITAENIVDPELENSKTGARFIIVLPFAR
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgacaaaaaatactcaactggaaaccctgcaaaaaataacaccaaatggtcttccctca
tctcccttttctatactttccgatttgcgctttcggacacaacgtcttctcagacaattg
cttttttccagtcttacacgccgtattgtcatcttaaatcttgctgcccttgctattctg
gttacaggcattttatatcttaatcaatttcgtgacggtttaattgaagcgaaaatcaaa
agcttatgtatccaaggaaaaattatcgctggagccattgctgcttctgcaacagtagat
acaaattctattctcattgatccccaaaagcttttagaattacaagctggagaaagcgtt
acacctgcacctcaatcaacagactcttgggactttcccattaatcctgaacaagttgct
cctcttttacgacgcctcatcacacctaaaacgacaagggcacgtatctatgatcgtgat
gctactttgcttcttgattcacgcgttctttattctagtggtgaagttttcagctatgat
ttacccccacttaaaactgaaaaaaaactgtgggagcgcctctattcatggttttcaaat
gcactttatggcaatggtcttgccatcgatagggagcaagcaaaaaaacggggtattgtt
catccagaagtttaccgagctcttaatggatcacttgcaaccgctaaacgacgcaacaga
caaggtcaattaatcgtttctgtcgccgtgcctgttcaacgctatcgagctgtggtaggt
gcgcttcttctttcaaccaccggttcggatattgatgacattgtaaaaggtgaaagactg
gttatttttaaagtttttgccgtcgtaggcagcgtgcttttggtactttctctcttttta
gcccatacgattgcgcatccattgagtaaattatctgcctccgccaatcgtgtgcgcaat
ggcaataataagcgtgttgaaattcccgatttttcaatgcgcgaagatgaaattggtcat
ctttcaacctctattcgtgacatgaccaatgccctttatatgcgtattgaagccattgag
cgctttgctgctgatgtaagccacgaattaaaaaatccgcttacctcactgcgtagtgct
gttgaaacccttcctttggctaaaaatgaagaagcacaggaacaattgattgaaattatt
caacatgatgtgcgtcgtcttgaccgtttgattactgatatttctgatgcatcgcgactt
gatgcagaacttgctcgtgaaacggcgcaaattgttgatgtaacactacttttggaaagc
cttgttcatgctgttcaggaagtgtaccgtaataggcaaaacattgatataagccttaat
attatcccacgtcctcatggaaaaccttaccttgtattgggacatgaactccgtttaggg
caagtaatttccaatctcattgaaaatgcacgttctttcattccccatgataacggcaaa
atttgtataactatgaaaagtaatgctgcaaatcttgtcttaattattgaagataatggc
cctggtattcgctcagaaaatattgaacgcatttttgaacgcttttatactgatcgacca
agcgaagatacatttggacaaaactcaggactcggtctttctattagtcgacaaatcatt
gaggctcataatgggacaattacagcagaaaatattgttgaccccgaacttgaaaatagt
aaaactggcgcacgttttattattgtccttcccttcgctcgataa

DBGET integrated database retrieval system