KEGG   Bacillus halotolerans: DIC78_18125
Entry
DIC78_18125       CDS       T06619                                 

Definition
(GenBank) PTS fructose transporter subunit IIA
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bht  Bacillus halotolerans
Pathway
bht00051  Fructose and mannose metabolism
bht02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DIC78_18125
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    DIC78_18125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bht02000]
    DIC78_18125
Enzymes [BR:bht01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     DIC78_18125
Transporters [BR:bht02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    DIC78_18125
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: AZV50776
UniProt: A0A3T0LDU7
LinkDB
Position
3535346..3535786
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENHLIAVPFFKGEGIQTLQEKYHQTLQDIPKENE
VLFLVDIFGGTPYNAAASFIAKDQRMDMAAGINLPILLEVLSLREHLKLKELLNHLKKMS
QQSFQVCSEHLEKAKTVCEEKREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagtcattattagcggacatggggactttcccatagcattaaaagaatcttca
ggcatgatattcggtgaagaaaatcatctgatagcggtgccgttttttaaaggagagggc
atccaaacgctgcaagaaaaatatcatcagacgcttcaggatattccgaaagaaaatgag
gtgctttttttagttgatatttttggaggcacaccgtataacgcagcggcttccttcatc
gctaaggatcaaagaatggatatggctgccggcataaacctgccgatactactggaggtt
ttaagcctgagagaacatctgaaactcaaagaattgctgaatcacttaaaaaaaatgagc
cagcaaagctttcaagtttgcagcgaacatttagaaaaagcaaaaacagtttgtgaagaa
aaaagagaggatgaactatga

DBGET integrated database retrieval system