KEGG   Bordetella hinzii: ACR54_00538
Entry
ACR54_00538       CDS       T04004                                 

Definition
(GenBank) hypothetical protein
Organism
bhz  Bordetella hinzii
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: AKQ53890
UniProt: A0A0H4VV96
LinkDB
Position
complement(543138..543887)
AA seq 249 aa
MSDPAVAAQRQQQRQQGLIAGLVTLPFRFFGVLCGALLLCILIECVGMHFFWPDQGWRHA
QGMLHYELDQLSTHFTRSALVQEPGRTAHRLVEQGYDWLFVKSGLLDGIRDASAQASAGS
HRPTKDFRYYIGLVYVNVESYLIAAAYTTLVFLVRLLVLCLTLPLFLMAAFVGLVDGLVR
RDIRRFGAGRESGFIYHRARASLIPLAVLPWVTYLALPVSVNPLLILLPSAALLGVAVCI
AAATFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagcgatccggccgtcgcggcacagcgccagcagcaacgacagcaggggctgatcgcc
ggcttggtcacgctgccgttccgcttcttcggcgtgctgtgcggcgcgctgctgctgtgc
atcctgatcgaatgcgtcggcatgcacttcttctggcccgatcagggctggcgccacgcg
cagggcatgctgcactacgagctggatcagctctccacgcatttcacgcgcagcgcgctg
gtgcaggagccggggcgcaccgcgcaccggctggtcgagcagggctacgactggctgttc
gtgaaaagcggtctgctggacgggatacgcgacgcctcggcgcaggccagcgccggcagc
catcgcccgaccaaggatttccgctactacatcggcttggtctatgtgaacgtggaaagc
tacctgatcgcggcggcctacacgacgctggtcttcctcgtgcggctgctggtgctgtgc
ctgaccctgccgctgttcctgatggccgccttcgtcggcctggtggacggcctggtgcgc
cgggacatccgccgcttcggcgcgggacgcgaatcggggttcatctatcaccgcgccagg
gccagcttgatcccgctggccgtgctgccgtgggtgacatacctggcactgccggtcagc
gtgaacccgctgctgatcctgctgcccagcgccgcattgctcggcgtggcggtgtgcatt
gcggcggcgacgttcaagaagtatctgtag

DBGET integrated database retrieval system