KEGG   Bordetella hinzii: ACR54_02462Help
Entry
ACR54_02462       CDS       T04004                                 

Gene name
gstB_4
Definition
(GenBank) Glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bhz  Bordetella hinzii
Pathway
bhz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bhz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACR54_02462 (gstB_4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bhz02000]
    ACR54_02462 (gstB_4)
Enzymes [BR:bhz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ACR54_02462 (gstB_4)
Transporters [BR:bhz02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACR54_02462 (gstB_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AKQ55777
UniProt: A0A0H4VZ33
LinkDB All DBs
Position
2563742..2564365
Genome map
AA seq 207 aa AA seqDB search
MSRWTFYTAPGTCALATHIALHEAGAEFDLVKLDMSANQQQSPAYLSVNPKGRVPALATE
HGVLTETPALLAFVAQRFPAARLAPLDDPFAFARMQELASYLASTAHVAHAHKRRGARWA
DDPAAHEAMRAKVPQTMTACAAYLESQIAGPWVAGEAYSAVDGYLFTVGSWLEGDGVDMS
RFPKLSAYLARVAARPAVQRALAEAQA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgctggactttctacaccgcccccggcacctgcgcgctggccacccatatcgcc
ctgcacgaagccggcgccgagttcgacctggtcaagctggacatgtcggccaaccagcag
caaagcccggcctatctgagcgtcaaccccaagggccgcgtgccggccctggccaccgag
cacggcgtgctgaccgagaccccggccctgctggcctttgtcgcccagcgcttcccggcc
gcgcgcctggcgccgctggacgaccccttcgccttcgcccgcatgcaggagctggccagc
tacctggcttcgaccgcccacgtcgcgcacgcgcacaagcggcgcggcgcgcgctgggcc
gacgacccggccgcgcacgaagccatgcgcgccaaggtgccgcagaccatgacggcctgc
gcggcctacctggaatcgcagatcgccgggccctgggtggcgggcgaggcctacagcgcc
gtcgacggctacctcttcaccgtgggcagctggctggaaggcgacggcgtggacatgagc
cgcttccccaagctgtccgcctacctggcccgcgtggccgcccgcccggccgtccagcgc
gcgctcgccgaagcgcaggcctga

DBGET integrated database retrieval system