KEGG   Bacillus intestinalis: BIS30_02885
Entry
BIS30_02885       CDS       T05513                                 

Definition
(GenBank) PTS mannose transporter subunit IID
  KO
K02771  fructose PTS system EIID component
Organism
bit  Bacillus intestinalis
Pathway
bit00051  Fructose and mannose metabolism
bit02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BIS30_02885
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BIS30_02885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bit02000]
    BIS30_02885
Transporters [BR:bit02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BIS30_02885
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AJW84199
LinkDB
Position
complement(497543..498370)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLAVGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFIIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggaaaaagaaaaacgattaacgaaaaaagaaattttcagcatgtttattcgttcaaat
tttttgctcggctcctttaacttcgaacgtgtgcaggccatggggtattgctatgtcatg
ataccggcgatcaaaaaattgtacggacctggagcgaaaagaaacgaagccttgcagcgg
catttggagtggtttaatacacacccgtggctgacagcgcctatattcggtgtgacggct
gccatggaagaagaaatggcgaacaataaaggaattgatggaaaagcaataagcggaatg
aaaatcggtttgatgggcccgatagcgggtgtaggcgatccgattttctggggaacgatt
cgcccggtcttagctgcgttaggggcatctcttgctgtaggaggaaacattgccggccct
ttgctattctttttcttgctgaacgccataagattaagcacaaaatattatgggttaaaa
tatggctatgtgaaaggaatggagattctgcaggatttagcggggaatcgcattcaaaag
cttacagagggtgcttcgattctcgggttatttgtaatgggagctctcgtttccaagtgg
accacgatcaacattccaatcgttgtgtccaggattaaggatgaaagcggaaaagtggat
gttcaaaccgtacaaaatgtgttagacagcattatgccgggtgcgctgcctctagggtta
acattattggtggcatggatgctgcgcaaaggtgtgaatcctcttctcattatttgcggg
atctttattatcgggattcttggatattgggctggattcttagcataa

DBGET integrated database retrieval system