KEGG   Bacillus intestinalis: BIS30_02890
Entry
BIS30_02890       CDS       T05513                                 

Definition
(GenBank) PTS mannose transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
bit  Bacillus intestinalis
Pathway
bit00051  Fructose and mannose metabolism
bit02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BIS30_02890
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BIS30_02890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bit02000]
    BIS30_02890
Transporters [BR:bit02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BIS30_02890
SSDB
Motif
Pfam: EII-Sor TMEM251
Other DBs
NCBI-ProteinID: AJW84200
LinkDB
Position
complement(498392..499195)
AA seq 267 aa
MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIH
RADRYAKEGNIKGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPDVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KHNAHGAVAAASDGGHVAVYDDDDLDA
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtcttcattacaaattattttgttgttaatcattgcagcaatcaccggcattgcaagt
gtgttggatgaggggcagacacaccggccgcttgtggcctgcacgttagtcggtttggtg
ctcggggatttaaaaacaggaattattctcggagggactctggagctgatggcgctgggc
tggatgaacgtcggccttgccatggcacctgatacagcgatcgcctctgtcatttcaacc
attttagtcattaccgccgatcagggaattggcgaagggattgcggttgctgttgcttta
gcagctgctggtcaggcgctgactatttttgtgcggacgatcactgtctttttcattcac
cgcgctgatcgatatgcaaaagaagggaatataaaaggaattgaaattatgcatataacc
gcgatggtgtttcaagcactgcgcgtgatgataccgacattgattgtcgcattgatcagt
gtcagcgctgttcaggcgttcttgggaaatattccggatgtgattacaaaagggctgcaa
ataggcggaggcattatcgtggttgtcggatatgccatggtgatcaatatgatgaatatt
ccttatttgaagccatttttctatattggatttttattagcagcgtttaccgatttcaac
ttagtgggatttggagcccttggtctctgtctggcacttttataccagcaggtgatgcaa
aaacataacgctcacggagcagttgctgccgcttcagatggcggccatgtggctgtttat
gatgacgatgaccttgatgcctaa

DBGET integrated database retrieval system