KEGG   Bos indicus (zebu cattle): 109554664
Entry
109554664         CDS       T04792                                 

Gene name
CD5
Definition
(RefSeq) T-cell surface glycoprotein CD5
  KO
K06455  T-cell surface glycoprotein CD5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109554664 (CD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109554664 (CD5)
CD molecules [BR:biu04090]
 Proteins
  109554664 (CD5)
SSDB
Motif
Pfam: SRCR Comm
Other DBs
NCBI-GeneID: 109554664
NCBI-ProteinID: XP_019810892
UniProt: A0A6P5BE32
LinkDB
Position
29
AA seq 495 aa
MGSQHLPLAXLYLLELLVTSCLGGLKVEVQGLXMRLSGSGSRCQGRLEVSNGTEWYXVHS
QSWGQLSLYQVAPRQFLKLCQELQCRDPLLLSSSRYFKEXQFQKLIICHGQLGSFSNCSX
NRGRQVDSLALXCLEPPRTTAPPTTSPPTTTPEPTAPPRFQLVAEPGGLRCAGVVEFYSG
GLGGTIGIEPQNDIKDLGQLICAALQCGSFLKPLPETEEAQTQKPEGQRPLPIRWEIQNP
KCTSLEQCFRKVQPWVGGQALGLICSDFQPKVQSRLVGGSDVCEGSVEVRSGKGQKWDTL
CDDSWAKGTARWEEVCREQQCGNVSSYRGLDPSEKTLGGFYCPPGILSRCHKLEEKKSHC
KRVFVTCQNSSRAGLGAGAVMSIILALVLLAVLLVVCGPLAYKKVVKKFRQKKQRQWIGP
TGMNQNMSFHRNHTVTVRSQVENATASHVENEYSQPPRNSQISAYPALEGALHRISTQPD
NSSDSDYELHGAQRL
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggggtctcagcatctgccactggccgyyctgtaccttctggagctgctggtcacttcc
tgcctcggagggctcaaggtggaggtgcaagggctcrccatgagactgagcggctccggc
tcacggtgtcagggccgtctggaggtcagcaacgggacagagtggtacgyggtrcacagc
cagagctggggccagctttcgctctaycaggtggctcccaggcagttcttgaagctgtgc
caggagctgcagtgccgggaccctttgttactctcttcctcgcgttacttcaaagaggkg
caattccagaaattgataatctgccatggacagctgggatccttctccaactgcagcstc
aacaggggacgccaggtggactctctggccctgwtctgcttagagccaccgaggacaaca
gctcctcccacgacctcaccgcccacaaccactccggagcccacagcacctcccaggttt
cagctggtggcagagcccgggggcctgcgrtgtgctggcgtggtggagttctacagtggt
ggcctgggcggcaccatcggcatcgagccccagaatgatatcaaggacctggggcaactc
atctgtgcagccctccagtgtggctccttcctgaagcccctgccagagaccgaggaagcc
cagacacaaaagccagaaggccaaaggcccttgccaatccgctgggagatccagaaccca
aaatgcacctccctggagcagtgcttccgaaaagtgcagccctgggtgggtggccaagct
cttggcctcatctgttctgatttccagcccaaggtgcagagccgcctggttgggggcagc
gacgtgtgcgaaggctccgtggaagtgcgcagtgggaagggccagaagtgggacacgcta
tgtgacgattcctgggccaagggcacggcacggtgggaggaggtgtgccgggagcagcag
tgcggcaacgtcagctcctaccgggggctggaccccagcgagaagaccttggggggcttc
tactgtcccccggggatactgtcccggtgccacaagcttgaggagaaaaagtcgcactgc
aagagggtgtttgtcacatgccagaactccagccgagcgggcctgggcgcgggcgccgtg
atgagcattattttggccctcgtgcttctggcggtgctgctggtcgtgtgtggccccctg
gcctacaagaaggtggtgaagaaattccgccagaagaagcagcgccagtggattggccca
acgggaatgaaccagaacatgtctttccatcgcaaccacacggtgactgtccggtcccag
gttgagaacgccacggcctcccacgtggagaacgaatacagtcagcctcccaggaactcc
cagatctcagcttatccagctctggaaggggccctgcaccgcatctccacccagcctgat
aactcctccgacagtgactatgagctacacggggctcagaggctgtaa

DBGET integrated database retrieval system