KEGG   Bos indicus (zebu cattle): 109556472
Entry
109556472         CDS       T04792                                 

Gene name
GP5
Definition
(RefSeq) platelet glycoprotein V
  KO
K06260  platelet glycoprotein V
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04512  ECM-receptor interaction
biu04611  Platelet activation
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109556472 (GP5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109556472 (GP5)
   04611 Platelet activation
    109556472 (GP5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556472 (GP5)
CD molecules [BR:biu04090]
 Proteins
  109556472 (GP5)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRR_1 LRRCT
Other DBs
NCBI-GeneID: 109556472
NCBI-ProteinID: XP_019813353
UniProt: A0A6P5B4C6
LinkDB
Position
1
AA seq 539 aa
MLRSALLCAALWLLRAQPFPCPPTCRCAFRDAAQCSRGTVAGIAALGLPTNLTHILLFQM
GRGTLQNNSFSDMTVLQRLLLSDSHXSAIAPGTFNDPIKLKTLRLSRNKITHLPSALLDN
LVLLEQLFLDGNELKSLDQNLFQKLVHLQELFLNQNQLAFLPASLFTHLGNLKLLDLSGN
NLTHLPEGLFGVQVKLQKLLLHSNRLASLESGLLDSLRALTELQLHTNHLRSIVPGAFDR
LRSLSSLTLSENRLEFLPSALFLHSHNLTFLTLSENPLEELPKVLFGEIGGLRELRLKST
QLRTLPAAAFRNLTGLRVLEVSLSPRLSALPXXAFRGLGELQVLALSSTGLASLPAGLLR
GLCRLRHVSLRSNRLRALPSALFRNLSSLEEVQLDHNQLETLPGDAFEALPRLAGVLLGH
NPWRCDCGLGPFLAWLRRHAGLVGRAEPPRCHGPGPHAGRLLWTLQAGDLGCPRPESWTR
LVAEGQSQDHNLFWGLYFLLLAAQALITGIIVFAMIKLCRLFRKLITELWFEAVRKPCN
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgctgaggagcgctctgctatgcgcggcgctctggctcctgcgcgcgcagccctttccc
tgcccacccacctgcaggtgcgccttccgcgacgccgcgcagtgctcgcgcggcacggtg
gccggcatcgccgcgctcggcytgcccaccaacctcacgcacatcttgctcttccaaatg
ggccgcggcaccttgcagaacaacagcttcagtgacatgaccgtcctgcagcgcctgttg
ctgtccgacagccacgyttccgccattgccccgggcacgttcaacgaccctataaaactt
aaaaccctgaggttatcgcgcaacaagatcactcatctcccaagcgcactgttggataac
ctggtgctcctggaacagttgtttctggacggcaatgaactaaagagccttgaccaaaac
ctgtttcagaaactggttcacctgcaggagctctttctgaaccaaaaccaactcgctttc
ctgcctgctagcctcttcacacacctggggaacctgaaattgttggatttatcgggaaac
aatttgacccacctgcccgaggggttgtttggggtccaggttaagcttcagaagcttctg
ctccactcgaaccggctggcctctctggagtcggggctgttggacagcctgcgcgccctg
acggagctgcagctccacaccaatcacctccgttccatcgtccccggagccttcgaccgg
ctgcgaagcctgagctccttgaccctttccgaaaaccgcctcgagttcctgccctctgcc
ctctttcttcattcgcacaatctgaccttcctgaccctgtctgagaacccgctggaggaa
ctccccaaggtgctcttcggggagataggcggcctgcgggagctgaggctgaaaagcacc
cagctgcgcaccctgccggccgccgccttccgcaacctcactggcctgcgcgtcctggag
gtgtcgctgagcccgaggctgagcgcgctcccgnnnnncgccttccgaggcctcggcgag
ctgcaggtgctcgccctgagctccacaggcctggcctccctccccgccggcctgctccgc
ggcctctgcaggctgcgccacgtgtcgctgcgcagcaatcggctgcgcgccttacccagc
gctctcttccgcaacctcagcagcctggaggaggtccagctcgaccacaaccagctggag
accctgccgggcgacgcgtttgaagctctgccccggctggcgggggtcctgctgggacac
aatccctggcgctgcgactgtggcctggggccgttcctggcgtggctgcggcggcacgcg
ggcctcgtgggtcgagctgagcccccgcggtgtcacgggcccgggccgcacgccggccga
ctgctctggaccctgcaggccggcgacctcggctgcccgcgccccgagtcgtggacccgg
ctggtggctgagggccaaagtcaggaccataacctgttctggggtctttattttctgctt
ttagctgctcaggccctaattaccgggatcattgtgtttgcgatgattaaactctgcagg
ctctttcggaaattaatcacagagctctggtttgaggcggtgagaaaaccttgcaattaa

KEGG   Bos indicus (zebu cattle): 109574196
Entry
109574196         CDS       T04792                                 

Gene name
GP1BA
Definition
(RefSeq) platelet glycoprotein Ib alpha chain
  KO
K06261  platelet glycoprotein Ib alpha chain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04512  ECM-receptor interaction
biu04611  Platelet activation
biu04613  Neutrophil extracellular trap formation
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109574196 (GP1BA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109574196 (GP1BA)
   04611 Platelet activation
    109574196 (GP1BA)
   04613 Neutrophil extracellular trap formation
    109574196 (GP1BA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109574196 (GP1BA)
CD molecules [BR:biu04090]
 Proteins
  109574196 (GP1BA)
SSDB
Motif
Pfam: LRR_8 LRR_4 Cornifin LRR_9 LRRNT CrgA
Other DBs
NCBI-GeneID: 109574196
NCBI-ProteinID: XP_019837597
UniProt: A0A6P5DKB6
LinkDB
Position
19
AA seq 706 aa
MEAVPGFWEPISGCHFLPIPTLFLPLTRPSLELEDRRTKSHPGRSSVSPEVLLPVTMPLL
LLLLLLPSPSHPVPICEVGNKDSQVEVNCENKGLKAPPPDLPADTAILHLGENPLGTFSM
ASVLNLSQLTELFLGKSQLTSLQADAKLPRLEVLNLAHNKLRSLPKLGRALPVLSILDVS
FNELTSLPSDTLHGLSRLQELYLRGNQLRTLPPELLVPTPHLKKLSLAENDLQELPPELL
KGLEELDTLYLQKNRLRTIPTDFFGMLLLPYAFFHNNSWSCDCGILYFSRWLQDNPSNVY
VWEEDVDIKAMTPDVKSVRCVNMNGMYVYNFLGDGCNIPGDRDNLXYDEYEDKDEQEVSV
VNTVSSLSSHTXHWDLLYLTSPTSPGSQVSSLPPVKKLTTTPITIDSITSSKTLNPTTEP
PTTPTTPESTTPTTPEPTIPTTPEPTTPTTPEPTTPTTPEPTTPTTPEPTTPTTPEPTTP
TTPEPITPTTPEPTTPTTPEPTTPTTPEPTTPTTPEPTTPTTLEPTTPTTPEPISETLQP
TIFLTSTESISLPTILESTITIISESDNPWKVQGLASSSNNPVLSSDSCCLFLGFYILGL
LWLLVASVILILLLCWVQQVKPWXLATATHTAHLELQRGRQVMVHRAWLLFFQGLLPTFR
SSLFLWVRPNGRMGPLQAGRRPSALSLGRGGDLLGTVGVRYSGHSL
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggaggctgttcccgggttctgggagcccatatcaggctgccatttcctccccatccct
accctcttcctgcccctaaccaggccctccctggagctggaagacagaaggaccaagtca
caccctggaagaagctctgtgtctccggaggttcttctgccggtcaccatgcccctcctc
ctcttgctgctcctgctgccaagcccttcacaccctgtccccatctgtgaagtcggcaac
aaggacagccaggtagaagtgaactgtgaaaataagggactgaaggcaccgcctccagac
ctgccggcggacaccgccatcctccacctgggtgagaaccccctgggcactttctccatg
gcatccgtgttgaatctgtcccagctcactgagctgttcctgggtaagagccagctgacc
agcctgcaggcagatgcgaaactgccacggctggaggtcctgaatctagcccacaataag
ctgagaagcctgcccaagttgggacgggcactgccagttctctccatcctggacgtgtcc
ttcaacgagctgacctcattgccttctgatactctgcatggcctgagccgcctccaagag
ctctatctgcgcggaaaccagctgaggactctgccccctgagctcctggtgcccacgccc
cacctgaagaagctcagcctggctgaaaacgacttgcaagagctgccccctgagcttcta
aaagggttggaggaacttgacaccctctacctccaaaagaacaggctgcgcacaatacca
acggacttctttgggatgctcctcctgccttacgcttttttccataacaactcctggtcc
tgtgactgtgggatcctctatttcagccgctggctgcaggacaaccccagcaacgtgtac
gtatgggaggaggatgtggacattaaggccatgacccccgatgtgaagagcgttcgatgt
gtcaatatgaatggcatgtacgtctacaacttcttgggtgatggctgcaacatccctggt
gacagggacaacctggastacgatgaatatgaagacaaagacgaacaggaggtatctgty
gtgaacactgtaagcagcctctctagccacaccaygcactgggacctgctctatttaaca
tcgcctacttcgccaggcagtcaagtgtcctccttgcctccagttaagaaattgaccacg
accccgattactatagactccatcacctcctccaaaactctaaaccccactactgagccc
cccacaaccccaaccactccagaatccacaaccccgaccaccccagagcccacaatcccg
accaccccagagcccacaaccccgaccaccccagaacccacaaccccgaccaccccagag
cccactaccccgaccaccccagagcccacaaccccgaccaccccagagcccacaaccccg
accaccccagagcccataaccccgaccaccccagagcccacaaccccgaccaccccagag
cccactaccccgaccaccccagagcccactaccccgaccaccccagagcccacaactccg
accaccctagagcccactaccccgaccaccccagaacccataagtgagactttacaacca
accatattcttaacctccacagaatccatttcactccccactatcttggaatccaccata
accatcatctctgaatctgacaacccctggaaagtccagggattggctagttccagtaac
aaccctgttctcagctctgactcttgctgtctgttcctgggcttctatatcttgggtctc
ctctggcttctcgttgcctctgtgatcctcatcctgctgctgtgctgggtccagcaggtg
aagccatggrccctggccacggccacccacacggcrcacctggagctgcagaggggaagg
caggtgatggtacaccgggcctggctgcttttcttccaaggcttacttcccactttccgc
tctagccttttcctgtgggtgcggcctaatggccgcatggggcctctgcaggcaggtcgg
cggccttcggccctgagcctgggtcgtggtggggatctgttggggacagtgggtgttagg
tactctggccacagcctctga

KEGG   Bos indicus (zebu cattle): 109576426
Entry
109576426         CDS       T04792                                 

Gene name
GP9
Definition
(RefSeq) platelet glycoprotein IX
  KO
K06263  platelet glycoprotein IX
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04512  ECM-receptor interaction
biu04611  Platelet activation
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109576426 (GP9)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109576426 (GP9)
   04611 Platelet activation
    109576426 (GP9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109576426 (GP9)
CD molecules [BR:biu04090]
 Proteins
  109576426 (GP9)
SSDB
Motif
Pfam: LRR_8 LRRNT LRR_4
Other DBs
NCBI-GeneID: 109576426
NCBI-ProteinID: XP_019840611
UniProt: A0A6P5DQW1
LinkDB
Position
22
AA seq 180 aa
MPAWVALLLFWXAAEASEDCPAACACRALDTMGLQVDCRGRGLEVLPALPAPTRELLLTN
NSLQSVPPGAFDHLPQLQALDLAHNPWRCDCGLVYLRLWLEXRAPEQLLRLRCAGPAHAA
DRTPAQLSGSELGGCGWTLRESWAGPGSWWDAALVVVAALGLALLVSLLCTIPVPRASPR
NT seq 543 nt   +upstreamnt  +downstreamnt
atgcccgcgtgggtggcgctgctgttgttctggnnggccgccgaggcctccgaggactgc
ccggccgcgtgcgcctgccgtgcgctggacaccatggggctgcaggtggactgccgcggc
cgcgggctcgaggtgctccccgccctgccggcccccacgcgcgagctcctgctgaccaac
aacagcctgcagagcgtgccccccggcgccttcgaccacctgccgcagctgcaggccctg
gatctggcgcacaacccgtggcgctgcgactgcggcctcgtctacctgcgcctctggctg
gaggnncgcgcgcccgagcagctgctgcgcctgcgctgcgccggccccgcccacgccgcg
gaccgcacgcccgcccagctcagcggctcggagctgggcggctgcggctggaccctgcgc
gagtcctgggctggcccggggtcctggtgggacgcggcgctggtcgtcgtggccgcgctg
ggcctggctctcctggtgagcctgctgtgcaccatcccggtgccccgggccagcccccgg
tag

DBGET integrated database retrieval system