KEGG   Bos indicus (zebu cattle): 109560714
Entry
109560714         CDS       T04792                                 

Gene name
CTBP1
Definition
(RefSeq) C-terminal-binding protein 1
  KO
K04496  C-terminal binding protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04330  Notch signaling pathway
biu05200  Pathways in cancer
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109560714 (CTBP1)
   04330 Notch signaling pathway
    109560714 (CTBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560714 (CTBP1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109560714 (CTBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109560714 (CTBP1)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Macropinocytosis
   Others
    109560714 (CTBP1)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C Cellsynth_D
Other DBs
NCBI-GeneID: 109560714
NCBI-ProteinID: XP_019818732
UniProt: A0A6P5C0F0
LinkDB
Position
6
AA seq 441 aa
MAGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAV
GALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADS
TMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGVIGLGRVGQAVAL
RAKAFGFNVLFYDPYLADGTERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFT
VKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLI
CTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLAAATHWASVDPAVVH
PELNGAAYRYPPGVVGVAPSGIPAAVEGIVPSAMSLSHGLPPVSHPPHAPSPGQTVKPEA
DRDHASDSCSRAELCNRGAGR
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcaggcgtccgacctccgatcatgaacgggcccatgcacccccggcccctggtggcg
ctgctggacggccgggactgcacggtggagatgcccatcctgaaggacgtggccaccgtg
gccttctgtgacgcgcagtccacgcaggagatccacgagaaggtcctgaacgaggccgtg
ggcgcgctgatgtaccacaccatcacgctgaccagggaggatctggagaagttcaaggct
ctgcggataatcgtgcgcatcggcagcggcttcgacaacattgacatcaagtcggccggg
gacctaggcattgccgtctgcaacgtgccggccgcatccgtggaggagaccgctgactcc
accatgtgccacatcctcaacctgtaccgcaggaccacgtggctgcaccaggcgctgcgg
gagggcacgcgcgtccagagcgttgagcagatccgggaggtggcctccggagccgccagg
atccgcggggagaccctgggcgtcatcgggctagggcgcgtggggcaggcggtggcactg
cgggccaaggcctttggcttcaacgtgctcttctacgacccctacctggcggacggcacg
gagcgggcgctggggctgcagcgggtcagcacgctgcaggacctgctcttccacagcgac
tgcgtgaccctgcactgcggcctcaacgagcacaaccaccacctcatcaacgacttcacc
gtcaagcagatgagacaaggggctttcctggtgaacacggcccggggaggcctggtggac
gagaaggctctggcccaggccctgaaggaggggcggatccgtggcgcagccctggacgtg
cacgagtcagagcccttcagctttagccagggccccttgaaggacgcgcccaacctgatc
tgcaccccgcatgcggcctggtacagcgagcaggcctccatcgagatgcgtgaggaggca
gccagggagatccggagagccatcacaggccggatccccgacagcctgaagaactgcgtc
aacaaggaccacctggcggccgccacccactgggccagcgtggaccccgccgtggtacac
cctgagctcaatggggccgcctacaggtaccccccgggcgtggtaggcgtggcacccagc
ggcatcccggccgccgtggagggcatcgtccccagcgcgatgtccctgtcccacggcctg
ccccccgtctcccaccctccccacgccccttctcccggccaaaccgtcaagcccgaggcg
gatagagaccatgcgagcgacagttgtagccgggcggagctctgcaaccggggcgctggc
cga

KEGG   Bos indicus (zebu cattle): 109579110
Entry
109579110         CDS       T04792                                 

Gene name
CTBP2
Definition
(RefSeq) C-terminal-binding protein 2 isoform X1
  KO
K04496  C-terminal binding protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04330  Notch signaling pathway
biu05200  Pathways in cancer
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109579110 (CTBP2)
   04330 Notch signaling pathway
    109579110 (CTBP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109579110 (CTBP2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109579110 (CTBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109579110 (CTBP2)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Macropinocytosis
   Others
    109579110 (CTBP2)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Other DBs
NCBI-GeneID: 109579110
NCBI-ProteinID: XP_019844163
UniProt: A0A6P5E0Q1
LinkDB
Position
26
AA seq 445 aa
MALVDKHKVKRQRLDRICEGIRPQIMNGPLXPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVLFYDPYLQDGTERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTTAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcccttgtggataagcacaaagtcaagcgacaacgattggacagaatttgcgaaggt
atccgcccccagatcatgaacggccccctryacccccgccccctggtggcgctgctcgac
ggcagagactgcaccgtagagatgcccatcctgaaggacctggccaccgtggccttctgc
gacgcacagtccacccaggagatccacgagaaggttttaaacgaggcagtcggtgccatg
atgtatcacaccatcacgctcaccagggaggacctggagaagttcaaggccctgagagtg
atcgtgcggataggcagcggctatgacaacgtcgacatcaaggctgcaggcgaactcggg
atygccgtgtgcaacatcccgtccgcggcrgtggaggagacggcggactcaaccatctgc
cacatccttaacctgtaccggcggaacacctggctgtaccaggcgctgcgggaaggcaca
agggtgcagagcgttgagcagatccgggaggtcgcctcgggggccgcccgcatccgcggg
gagacactgggcctcattggcttcggtcgcacggggcaggcggttgccgttcgagccaag
gcctttggattcagcgtcctattttatgacccctacttgcaggatgggacggagcggtcc
ctgggcgtgcagagggtctataccctgcaggacttactgtaccagagcgactgcgtctcc
ctgcactgcaatctcaacgagcataaccaccacctcatcaatgacttcactataaagcag
atgaggcaaggcgccttcctagtgaacgcagcccgcggtggactggtggatgagaaagcc
ttagcccaagccctcaaagaaggcaggatacgaggggcggccctcgacgtgcacgagtcg
gagcctttcagctttgctcagggtcccttgaaagatgcaccgaatctcatctgtactccc
cacacagcctggtatagtgagcaagcctcactggagatgcgggaggcggccgccaccgag
atccgccgggccatcacaggtcgcatcccagagagcttaagaaactgtgtgaacaaggaa
ttctttgtcacaacagctccctggtcagtaatagatcagcaagcaattcatccagagctc
aatggtgccacatacagatacccgccaggcatcgtgggcgtggctccgggaggacttcct
gctgccatggaagggatcatccccggaggcatcccggtgacccacaacctccccacggtg
gcacatccctcccaagctccctctcccaaccagcccacgaaacacggggacaatcgagag
caccccaacgagcaatag

DBGET integrated database retrieval system