KEGG   Bos indicus (zebu cattle): 109566428Help
Entry
109566428         CDS       T04792                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00590  Arachidonic acid metabolism
biu01100  Metabolic pathways
biu04611  Platelet activation
biu04726  Serotonergic synapse
biu04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109566428 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109566428 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109566428 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    109566428 (PTGS1)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109566428 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 109566428
NCBI-ProteinID: XP_019826332
LinkDB All DBs
Position
11
AA seq 600 aa AA seqDB search
MSRQGISLRFXLLLLLLSPSPVLPADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYYGPNCTIPEIWTWLRTTLRPSPSFVHFLLTHGRWLWDFVNATFIRDKLMRLVLTVR
SNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRR
FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGXPPQSQMAVGQEVFGLLPGLMX
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRELRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIXALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGDVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPHREDRPGVERPPTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagggtatctcgctccgattcycgctgcttctcctgctgctgtcgccgtcc
cccgtcttgccagcggaccccggggcgcccgcgccagtgaacccctgctgttactatcca
tgccagcaccaggggatctgtgttcgcttcggccttgaccgctaccaatgtgactgcacc
cgcacgggctattatggccccaactgcaccatccctgagatatggacctggctccggacg
actttgcggcccagcccgtctttcgtccactttctgctgacgcatgggcgctggctgtgg
gattttgtcaatgccaccttcatccgggacaagctcatgcgtctggtactcacagtgcgt
tccaaccttatccccagccctcccacctacaacatagcgcatgactacatcagctgggag
tccttctccaatgtgagttattatactcgcattctgccctccgtgccccgagactgtccc
acgcccatgggcaccaaagggaagaagcagttgccagatgcggagtttctgagtcgtcgc
ttcctgctcaggaggaagttcatccccgaccctcaaggcaccaacctcatgtttgccttc
tttgcccaacacttcacccatcagttcttcaaaacttctggcaagatgggtcctggcttc
accaaggcgttgggccacggggtagacctcggccacatttatggagacaatctggaacgt
cagtatcagctgcggctctttaaggatgggaaactcaagtaccagatgctcaatggagaa
gtgtacccgccatcggtggaagaggctcccgtgctgatgcactacccccggggcrtcccg
ccccagagccagatggccgtgggccaggaggtgtttgggctgcttcctgggctcatgstc
taygccacgatatggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggctgagcac
ccgacctggggygacgagcagctcttccagacggcccgcctcatcctcatcggggagacc
atcaagattgtgatagaggagtatgtgcagcagctgagcggctacttcctgcagctcaag
ttcgacccagagctgctgttyggggcccaattccagtaccgcaaccgcatcgccatggag
ttcaaccagctytaccactggcacccgctcatgcccgactccttccgggtgggcccccag
gactacagctacgagcagtttctgttcaacacctccatgctggtggactacggggtcgag
gccctggtggacgccttttctcgccagcctgcaggccggatyggtgggggtaggaacata
gaccaccacatcctgcacgtggccgtggatgtcatcaaggaatcgcgggagctgaggctg
cagcctttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaggag
ctcacaggggagaaggagatggcagctgagttggaggagctgtatggagacatcsatgct
ttggaattctacccggggctacttcttgagaagtgccatccgaactccatctttggggag
agtatgatagaaatgggggctcctttttcccttaagggcctcttagggaaccccatctgt
tctccagagtactggaaggcaagcacatttggtggtgaygtgggcttcaaccttgtcaag
acggccacgctgaagaagctggtttgcctcaacaccaagacttgtccctacgtctccttc
catgtgccagacccccatcgggaggacaggcctggggtggagcggccacccacagagctc
tga

DBGET integrated database retrieval system